ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_048600 ()

aspartate aminotransferase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10189

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_030230 aspartate aminotransferase, putative
  • PY00897 aminotransferase, classes I and II, putative
  • PVX_003655 aspartate aminotransferase, mitochondrial precursor, putative
  • PCHAS_030450 aspartate aminotransferase, putative
  • PKH_041530 aspartate aminotransferase, putative
  • TGME49_048600 aspartate aminotransferase, putative
  • NCLIV_064760 Contig An16c0190, complete genome. (EC 2.6.1.1) (Precursor), related
  • TP02_0046 aspartate aminotransferase, putative
  • TA12970 aspartate aminotransferase, cytoplasmic, putative
  • BBOV_III010960 aminotransferase, classes I and II family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_048600 aspartate aminotransferase, putative
MTLALFCGSAAGLLPRNVSRLRVDSKALPSSFLSWLPTSATPRTPEIKHTKRPSLKHPHARAEGREQENVSSLLLRSLAS
GSVVSLCLSLCTRSPATSLSSFSGVSALNRGYFSRTMATQSSLFDGVQEAPPDPILGLEVAFRADQDPRKVNLGIGAYRT
DDGKPYVFRCVRQVEQEMAADPNLYKEYLPIDGLPELKKQTQELLFGEDSSAIAEERICSAQVLSGTGGLRVAGEFLRYF
LPHCKTVYMSEPTWPNHPNIFKKAGLEVATYPYWNPATKGVDFENMKKTLESAAPYSVLLLHACAHNPTGVDLNEAQWRE
IMDLCKRKRLVPMIDNAYQGYASGDLQRDSFSSRLFCNEGNMELFVCQSFAKNMGLYGERIGMLHIVCANAERAKVVLSQ
VKKIIRPMYSSPPLHGARIVSRVLGDPNMKAAWMSELKELAGRIQSVRSALRSGLEAKQTPGTWRHITEQIGMFSYTGLS
REQAERMTKHWHVYMMNNGRISLAGLTQANLPYVVEAIDEVVRAVPAS

Gene-Specific Links for TGME49_048600

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins