ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_048340 (Ran)

GTP-binding nuclear protein RAN/TC4, putative, a gene from Toxoplasma gondii

Compiled localisation
nucleus during extracellular tachyzoite

Who localised this protein by microscopy?

Frankel, M. B., Knoll, L. J.
Functional analysis of key nuclear trafficking components reveals an atypical Ran network required for parasite pathogenesis. (2008 Oct, Mol Microbiol) PubMed / full text
   more detail about this publication

nucleus during extracellular tachyzoite
  • "In wild type parasites, TgRan was distributed throughout the cell, in both the nuclear and cytoplasmic compartments (Fig.οΎ 4A)."
  • Microscopy type: fixed light
  • Microscopy method: C terminal FLAG tag
  • Strain: Pru HXGPRT-
  • Gene model mapping comments: Taken directly from publication, annotation matches
  • Localisation record: nucleus during extracellular tachyzoite
  • Other genes localised in this publication: heat shock protein 90, histone H2B variant 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11018

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF11_0183 GTP-binding nuclear protein ran/tc4
  • PBANKA_093030 GTP-binding nuclear protein, putative
  • PY04253 GTP-binding nuclear protein ran/tc4
  • PVX_091515 GTP-binding nuclear protein Ran, putative
  • PCHAS_091400 GTP-binding nuclear protein, putative
  • PKH_091510 GTP-binding nuclear protein ran/tc4, putative
  • NCLIV_064310 GTP-binding nuclear protein Ran, related
  • cgd7_220 GTP-binding nuclear protein ran/tc4
  • Chro.70035 GTP-binding nuclear protein ran/tc4
  • CMU_006680 GTP-binding nuclear protein ran/tc4 , putative
  • TP01_0757 GTP-binding nuclear protein ran, putative
  • TA06865 small GTP-binding protein (RAN subfamily), putative
  • BBOV_IV010920 GTP-binding nuclear protein Ran
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_048340 GTP-binding nuclear protein RAN/TC4, putative
MAAAAAQAVPEFKLILVGDGGVGKTTLVKRHLTGEFEKKYIPTLGVEVHPLKFQTNFGMITFNVWDTAGQEKFGGLRDGY
YIKGQCAIMMFDVTARITYKNIPNWYRDITRVCENIPIVLVGNKVDVKDRQVKARQIQFHRKRNLQYYDISARSNYNFEK
PFLWLARRLTNQPALSFVGEHAKAPEIQIDPNLVQEAERELQAAVSTAIDDDDEDL

Gene-Specific Links for TGME49_048340

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins