ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_047550 (Hsp60, HSP60)

heat shock protein 60, a gene from Toxoplasma gondii

Compiled localisation
mitochondrion during intracellular tachyzoite and tachyzoite
two unknown vesicular bodies during bradyzoite

Who localised this protein by microscopy?

Saito, T., Nishi, M., Lim, M. I., Wu, B., Maeda, T., Hashimoto, H., Takeuchi, T., Roos, D. S., Asai, T.
A novel GDP-dependent pyruvate kinase isozyme from Toxoplasma gondii localizes to both the apicoplast and the mitochondrion. (2008 May 16, J Biol Chem) PubMed / full text
   more detail about this publication

mitochondrion during tachyzoite
  • "Construction of parasites stably expressing ptubFNRL-yellow fluorescent protein (YFP)-HA (labeling the apicoplast) and ptubHSP60L-RFP (labeling the mitochondrion) is described elsewhere (16)."
  • Microscopy type: Light
  • Microscopy method: RFP tag
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: mitochondrion during tachyzoite
  • Other genes localised in this publication: pyruvate kinase, putative, ferredoxin NADP+ oxidoreductase, putative, acyl carrier protein

Nishi, M., Hu, K., Murray, J. M., Roos, D. S.
Organellar dynamics during the cell cycle of Toxoplasma gondii. (2008 May 1, J Cell Sci) PubMed / full text
   more detail about this publication

mitochondrion during intracellular tachyzoite

Toursel, C., Dzierszinski, F., Bernigaud, A., Mortuaire, M., Tomavo, S.
Molecular cloning, organellar targeting and developmental expression of mitochondrial chaperone HSP60 in Toxoplasma gondii. (2000 Dec, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

mitochondrion during tachyzoite, two unknown vesicular bodies during bradyzoite
  • "Using immunofluorescence assays, the polyclonal antibodies specific to T. gondii HSP60 recognized the mitochondrion in tachyzoites, as expected. In contrast, these antibodies reacted against two unknown vesicular bodies which are distinct from the classical mitochondrial pattern in bradyzoites."
  • Microscopy type: Light, EM
  • Microscopy method: antibody to homologue
  • Strain: 76K PLK
  • Gene model mapping comments: blast from AF065609, annotation matches
  • Localisation record: mitochondria during tachyzoite, two unknown vesicular bodies during bradyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10230

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_047550 heat shock protein 60
MLARASARVAKCNPGNVFQVRHASSKEIRFGCDARNQMLAGCNRLADAVGVTLGPKGRNVVIEQPYGSPKITKDGVTVAK
SIELGNRMMNLGAQLVKQVASTTNDIAGDGTTTATLLARAIFREGCKAVDAGMNPMDLLRGINLAVEKVLAHLNSVTKNV
TTSEEIFNVATISANGDKVIGKLIADAMEKVGRDGTITVSEGKTLTHELELVEGLKFDRGYISPYFITNSKEQKVELEKP
FVLLYDKRISSVKSILPVLEFIVQNQGSLLIIAEDVDSEALATMVVNKLRLGLKICAVKAPGFGDHRKAMLHDIAVMTGG
QVVTEETGGSLEDAHQMPQMLGRAKSVTVTKDTTLVIEGGGEKATIDERCDQIRVSMEQTHSDYEKEKLQERLARMTGGV
AVIKVGGASEVEVGEAKDRIQDALCATKAAVEEGIVPGGGTALLYASETLKTIETTNYDQKVGVGIVRNACKQPCKTIAD
NAGHEGAVVVGNLLREADPTKGFNAQTGEYVDMMAAGIIDPTKVVKTALSDAASVASLMTTTEAAVVEAKEEKPDEPMGG
GMPMGGMGGGMGGMY

Gene-Specific Links for TGME49_047550

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins