ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_047230 (centrin)

caltractin (centrin), putative, a gene from Toxoplasma gondii

Compiled localisation
centrosome during tachyzoite
centriole during intracellular tachyzoite

Who localised this protein by microscopy?

Nishi, M., Hu, K., Murray, J. M., Roos, D. S.
Organellar dynamics during the cell cycle of Toxoplasma gondii. (2008 May 1, J Cell Sci) PubMed / full text
   more detail about this publication

centriole during intracellular tachyzoite

Hartmann, J., Hu, K., He, C. Y., Pelletier, L., Roos, D. S., Warren, G.
Golgi and centrosome cycles in Toxoplasma gondii. (2006 Jan, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

centrosome during tachyzoite
  • "At the beginning of the cell cycle, the centrosome is closely associated with one end of the growing Golgi stack (A). After the Golgi is fully grown, the centrosome migrates to the basal end of the parasite nucleus (B), where it divides (C), prior to moving back to the apical end of the nucleus and re-associating with the Golgi (D). During nuclear division (E), the two centrosomes are mostly found at the inner ends of the newly-divided Golgi, an association that persists through to the next cell cycle."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: RH
  • Gene model mapping comments: taken directly from publication
  • Localisation record: centrosome during tachyzoite
  • Other genes localised in this publication: gorasp2-prov protein

Morrissette, N. S., Sibley, L. D.
Disruption of microtubules uncouples budding and nuclear division in Toxoplasma gondii. (2002 Mar 1, J Cell Sci) PubMed / full text
   more detail about this publication

centriole during intracellular tachyzoite
  • "Toxoplasma centrioles were separated within G1/S phase transition (at the time of thymidine release, not shown). In replicating parasites (from 1 to 4 hours after release), the spindle microtubules (labeled with tubulin) are found in close proximity to the centrioles (labeled with centrin; Fig. 2B)."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: centriole during intracellular tachyzoite
  • Other genes localised in this publication: membrane skeletal protein IMC1

Striepen, B., Crawford, M. J., Shaw, M. K., Tilney, L. G., Seeber, F., Roos, D. S.
The plastid of Toxoplasma gondii is divided by association with the centrosomes. (2000 Dec 25, J Cell Biol) PubMed / full text
   more detail about this publication

centrosome

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12346

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_047230 caltractin (centrin), putative
MHSRKGASSLPRGRGAGKKTELTEEQRQEIKEAFDLFDTDGSGCIDAKELKVAMRALGFEPKKEEIRKMIADVDKDGTGS
VDFQEFLSLMTVKMAERDPREEILKAFRLFDDDETGKISFKNLKRVSKELGENLTDEELQEMIDEADRDGDGEINEEEFI
RIMRKTNLF

Gene-Specific Links for TGME49_047230

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins