ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_047210 ()

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>TGME49_047210 hypothetical protein
MNLGRLLFSLRILVHGGSASSVIPASTEDHGLSGDEGAVSASLGTSVYCFVLVKGCNLSTAVGGGTLYAVRWLAVEATSA
GYYDSSNRQTIDWTAHAVTLASSGTIPAGYVWSQSFSAWEDRPGTPGVLIGVQNHREMISAMYSSSEYLNPLVINSNSGG
TLTFSFLRQISHRIGFTLKAQRYDLKVNEVLPVADVVAGGTTPATFAVQWVTPTEAPLALVVKPKLLPDGSYSESLVAVE
DCRKGATYEPHAFDVTHAFTGNPASTAHRINGGPNCFRPSASVPTWLTEPCKLACESLWTANSDDYWNCDDVNACFETDF
RSAETLMALPQIDESIAEVLVTSCNFATRTADLIKQYEYAVNLKVDDIAIGTMWSTSSHCGGDKMEVEIVGAFYEKLGVS
ILTGSTCEVQDVSREVEALCKAEGGIGCSISGAQIYELIMNYPGVCFALEDAELQIFFNCTFGRSVRIRDAL

Gene-Specific Links for TGME49_047210

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins