ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_046550 (ASP3)

eukaryotic aspartyl protease, putative, a gene from Toxoplasma gondii

Compiled localisation
golgi apparatus during intracellular tachyzoite

Who localised this protein by microscopy?

Shea, M., Jakle, U., Liu, Q., Berry, C., Joiner, K. A., Soldati-Favre, D.
A family of aspartic proteases and a novel, dynamic and cell-cycle-dependent protease localization in the secretory pathway of Toxoplasma gondii. (2007 Aug, Traffic) PubMed / full text
   more detail about this publication

golgi apparatus during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_14295

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_046550 eukaryotic aspartyl protease, putative
MEGRTTAGRATPAGFWLFSCCLASLLWSANALIPAGKSAGSSFLAATSSQPSEEAPREFPGHLSNSQIASETGSALKIEE
IASSGSAPEVSGAAGASASKTSEKPIRPYHTGPSSRSSAYSASSGIPLCHTCSSFDAANGGCRLCVHGEVASDFLMPMMP
IRNIDTHREETLSRLEANHRTHLNEKKNFYVLRGKGPFGSLGNLPGTPGLDAAIAFGLSSPDLPSASFAQIKNKDSSDSG
DVAAVGEETDSAVADGSKTLDLDLKLAETSVPILQMKDSQYVGVIGIGTPPQFVQPIFDTGSTNLWVVGSKCTDDTCTKV
TRFDPSASKTFRAANPPVHLDITFGTGRIEGSTGIDDFTVGPFLVKGQSFGLVESEGGHNMHGNIFKTINFEGIVGLAFP
EMSSTGTVPIYDNIISQGTLKENEFAFYMAKGSQVSALFFGGVDPRFYEAPIHMFPVTREHYWETSLDAIYIGDKKFCCE
EGTKNYVILDSGTSFNTMPSGELGKLLDMIPSKECNLDDPEFTSDFPTITYVIGGVKFPLTPEQYLVRSKKNECKPAYMQ
IDVPSQFGHAYILGSVAFMRHYYTVFRRSDGTRPSLVGIARAVHNDDNSAYLSNVLNEYPGAHIRKEDLMMERSMSAPSM
REL

Gene-Specific Links for TGME49_046550

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins