ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_045670 (PDH E1-alpha, PDHE1a)

pyruvate dehydrogenase, putative, a gene from Toxoplasma gondii

Compiled localisation
apicoplast during intracellular tachyzoite

Who localised this protein by microscopy?

Fleige, T., Fischer, K., Ferguson, D. J., Gross, U., Bohne, W.
Carbohydrate metabolism in the Toxoplasma gondii apicoplast: localization of three glycolytic isoenzymes, the single pyruvate dehydrogenase complex, and a plastid phosphate translocator. (2007 Jun, Eukaryot Cell) PubMed / full text
   more detail about this publication

apicoplast during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10672

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_092380 pyruvate dehydrogenase E1 component, alpha subunit, putative
  • PVX_091840 pyruvate dehydrogenase E1 component, alpha subunit, putative
  • PCHAS_092060 pyruvate dehydrogenase E1 component, alpha subunit, putative
  • PKH_092200 pyruvate dehydrogenase alpha subunit, putative
  • NCLIV_062940 pyruvate dehydrogenase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_045670 pyruvate dehydrogenase, putative
MGASRVSPFLSRETGVSTTSELSSLCRVASCRLLPSACRFKLIVLLLAVVASPVLRDSRFVGITLASALNPSSAPSSLPT
VFSSAPTNSLPQTPVGPHVARVRLSPRIPVPLQTLSSPSNGISAAFVAPATLAGSTSPAPSFSLSTSFPEPDGAKTSPRT
RETARHSVPSSELAAVARPSSAHLSGVHPPAISPLSRGGTASSASRSHECPSMLGSERRTLSAAAARSGNQTGDFSSPDR
SCLSPQQQHRELVSPYVGQMLLEDMLTGRMVEDACARLYYMGKTAGFVHLYTGQEAVSAGVIKLLRPDDAVVSTYRDHVH
ATSKGVPVREVMAELFGKATGCSRGRGGSMHMFSKKHNMIGGFAFIGEQIPVALGYAFSAAYRRFAMGDKSDSNADQVAV
CFLGDGTTNMGQLYEALNIAALSKLPIVFVVENNNWAIGMAAQRSTATPAVWQRAESFGVAGVEVDGMDVLAVRGAARRA
IDRARRGEGPTLIEALTYRFRGHSVADPDEMRAVKQKEAWVVRDPIKSFEEELKRLGYASDETIAATRAKVKAVVDDAVK
FAETSPEPDVQECGQFIFAPPYTEAGKPEPLTNEQLHQYAVALKQELDAKARAKAGDKTPQPSVLQSANPPIVID

Gene-Specific Links for TGME49_045670

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins