ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_045490 (MIC8, MIC9) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

microneme protein 8, a gene from Toxoplasma gondii

Compiled localisation
microneme during intracellular tachyzoite
rhoptry
during not tachyzoite

Who localised this protein by microscopy?

Breinich, M. S., Ferguson, D. J., Foth, B. J., van Dooren, G. G., Lebrun, M., Quon, D. V., Striepen, B., Bradley, P. J., Frischknecht, F., Carruthers, V. B., Meissner, M.
A dynamin is required for the biogenesis of secretory organelles in Toxoplasma gondii. (2009 Feb 24, Curr Biol) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite
  • "We were not able to colocalize DrpB with markers of the secretory pathway, such as the cis-medial Golgi marker GRASP-RFP [20], the trans-Golgi marker UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T1 fused to yellow fluorescent protein (YFP) (TgGalNac-YFP; M. Nishi and D.S. Roos, personal communication) [4], the propeptide of M2AP (a precursor microneme protein that localizes in endosome-related compartments) [4], VP-1 (a vacuolar proton pyrophosphatase) [4], or the μ1 chain of the adaptin-1 complex 3."
  • Microscopy type: Light
  • Microscopy method: mCherry tag
  • Strain: RH hxgprt−
  • Gene model mapping comments: inferred from another publication
  • Localisation record: micronemes during intracellular tachyzoite
  • Other genes localised in this publication: dynamin-like protein, putative, mu1 adaptin, H+-translocating inorganic pyrophosphatase TVP, putative, MIC2-associated protein M2AP

Kessler, H., Herm-Gotz, A., Hegge, S., Rauch, M., Soldati-Favre, D., Frischknecht, F., Meissner, M.
Microneme protein 8--a new essential invasion factor in Toxoplasma gondii. (2008 Apr 1, J Cell Sci) PubMed / full text
   more detail about this publication

microneme
  • ""
  • Microscopy type:
  • Microscopy method:
  • Strain:
  • Gene model mapping comments: taken from sequence annotation on ToxoDB, as per user 'mf'
  • Localisation record: microneme
  • Other genes localised in this publication: -

Meissner, M., Reiss, M., Viebig, N., Carruthers, V. B., Toursel, C., Tomavo, S., Ajioka, J. W., Soldati, D.
A family of transmembrane microneme proteins of Toxoplasma gondii contain EGF-like domains and function as escorters. (2002 Feb 1, J Cell Sci) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite, rhoptry, during not tachyzoite
  • "Double labeling with mouse -MIC3 and rabbit -MIC8 confirmed the microneme localization of TgMIC8."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from AAK19757, annotation matches, gene model inconsistent
  • Localisation record: microneme during intracellular tachyzoite
  • Other genes localised in this publication: microneme protein MIC3, microneme protein MIC6, microneme protein 7
  • "MIC9Ty (red) colocalized with TgMIC3 (green). (D) In addition to the microneme localization, MIC9Ty (green) partially localized to the rhoptries, as documented by double IFA with -ROP2 (red)."
  • Microscopy type: Light
  • Microscopy method: Ty tag
  • Strain: RH
  • Gene model mapping comments: Blast from AAK19758, taken from sequence annotation on ToxoDB, as per user 'mf', gene model inconsistent TGME49_045490 is MIC8 and MIC9 joined together?
  • Localisation record: microneme and rhoptry
  • Comment: under TUB1 constitutive promoter
  • Other genes localised in this publication: microneme protein MIC3, microneme protein MIC6, microneme protein 7
  • "As expected from the RT-PCR results, both proteins are poorly or not expressed in tachyzoites of the Prugniaud (Fig. 7A) or RH (data not shown) strains."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH, Prugniaud
  • Gene model mapping comments: inferred from another publication
  • Localisation record: not during tachyzoite
  • Other genes localised in this publication: microneme protein MIC3, microneme protein MIC6, microneme protein 7

Orthology

OrthoMCL

Part of OrthoMCL group OG4_108107

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_045490 microneme protein 8
MRVSFNVPLHRTGFVLVCVIGSLCWCIAPAPECVFPATGLGPAAWNHPGSLAQMRAESKGVLSVTGICDRNPCGPHGNCI
PNLSTYTYTCSCEGGYVEAAVSGKPTCQRKDPCDTSPCGTKEAVKECRPNGQYYACICQAGYQVVSTNTGSRCQRIKSTT
TPCSSQPCGGPEAVEACLVTGPTTYSCTCASGYETITTEQGERCEKTDPCLSNPCGASKYVQSCTATNTGYTCECVKGAK
KTGSDSAPMCVAGESDMTQWYVAGGIGGCLCLFAVANRIWCFFAWRMVVRASFLKEMDSIFVSAIRQNVQHTHSALLAKL
KEPPDPDDENSWLCRISKKYDACGSREYSDKGLKWTFCPEDFCCSKTACFYGSCGSWCHDNWALCSSSIIYHDEYSYGKC
NCKRFQENCDVNAICVHANREDGGAYCQCKEGYWGDGKSCKIDFCQLQPCGAGTCTRTDEGYKCDCPETHKLIVVEDKET
CKAKPDFCAEEPCGPPSMVENCVNTDDSYECVCKQGYEVRNGRCEEIDLCADKPCGPDEGVHECVTERQPKLRYRCTCKA
GFDLTTLPDGVSQKCLKNFCYEEPCGTRDLVESCKSKAYGYSCLCAAGAMVQVINGKEKCIKADLCRNDPCGPETAVIQC
YSHGTSYRCLCKAGYTEVFVNGKSSCQKGDPCTLNMCGGNEAVQECTTDGTAYGCTCKPGYSIAIKHGQKFCNPEEECAS
HCGSAAAVKSCEILDSGGYQCTCNPGYVMRYSDYVKGCVEGNQCSLNPCGEQEAVQRCIPEGDTYDCECNPGFVKRVLPD
GNFICADPASCVGNPCGSSDAVDACIAGTSTYTCRCKDGYTPQSIGSKLQCLPESTDQTDFDSKHKPEDNKGRYSKGTIA
LVVVGCVALLGIIAGGISYARNRGGERDDEDLAPPPRSTRERRLSSMGEGFENASWASSVSMIPSAPAPPPSGGIWS

Gene-Specific Links for TGME49_045490

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins