ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_044470 ()

viral A-type inclusion protein repeat family, a gene from Toxoplasma gondii

Compiled localisation
ring structure at apical inner membrane complex during intracellular tachyzoite and very early daughter cell formation

Who localised this protein by microscopy?

Gould, S. B., Kraft, L. G., van Dooren, G. G., Goodman, C. D., Ford, K. L., Cassin, A. M., Bacic, A., McFadden, G. I., Waller, R. F.
Ciliate pellicular proteome identifies novel protein families with characteristic repeat motifs that are common to alveolates. (2011 Mar, Mol Biol Evol) PubMed / full text
   more detail about this publication

ring structure at apical inner membrane complex during intracellular tachyzoite and very early daughter cell formation
  • "TgME49_44470 is located in a ring-like structure at the apical end of the inner membrane complex (fig. 4A–I)."
  • Microscopy type:
  • Microscopy method:
  • Strain: RH Ku80-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Ring-like structure at the apical end of the inner membrane complex during intracellular tachyzoite and very early daughter cell formation
  • Comment: genomically integrated, native promoter
  • Other genes localised in this publication: hypothetical protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10046

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_044470 viral A-type inclusion protein repeat family
MHPHLSSAEPQEPSGDVSPTASSQLGSPARSTVVDRGDVDLPSHLLSRDSFATSVAVSRVPEEPCAGTTAQRFDSSESEY
PPPVSIFPQKYAADVSLVPGTAKAEGQESEGAQATALLQEPPSEDSPSLESKPLGASSFHRHTDNQPDPCAAPRESTVVT
ECRPEILVTSERESAVSLQRPPQDVETEKPTTDGLPPSRSLLPGKSVANVAVRVSAHPVTRSVVEVPVRESDLRPKVAAS
RPAPQVAPWRVDQETEAYPREEVSSDDELRAGAPAQPSLVTRSALPGMPSQPLARQPCPDPGAGIALAQAGFEPVLGAAG
APALRRSEPSVTGAVRNQAASSPPETELVPSGNRDNIAAPPGTRVAARHSEEVKSSPAEITEDTQFPSSAPPSFLGAPKG
RSSFGGHRNCVRAPYVVEREAAPVGTYYGAHRVCVIGPQRASPARRTSWWVVSNGEEPQRPLSMYWKERAKRWKCYNDTA
SQEAALRTRPPPGTEQKVTVVSRRPSPDLLAPSAGSAATVQRVETSPSARATSPGMHLVLSPQQRQEPDESLQALAEARD
AIQELERTLAEQEVRWRGDNMLKEGCIAYQDESIRLLKAQIKKLSEDLQCYATSNAFRRRETASLLRHLRVLRATRGARQ
GSIEGLQILYRKLEAARTMGIAAGSQTAAYLTGNQSITPPSPVGASYGDTPTCPHAPALQAQQPTSPASPSSALQSPSPG
EPLQSSFMVSPPAHVDQNAAYSPRSPGAVGVSVSTSITGLPQPDAPAPRPELIDAETEMSEAGFDELLGEREERRRREEE
EREEKRRREEEERQLLATEVKMLQQQLVILLEHEKQEEEKVRQQQGQLGLLQEQEKLLRAQAEEQESLQKQIVARLEAEA
MDHALKERRREELRQLVQETTTPFPFAPNPSRRNRALLPELPRLDALPQSPLPRTSSPSPAPFVGVGQGLPSPTHSPRWK
HRALDGEPLTLASPRGSSRSPTTLLLSKEDAQEREDLRRANEVLQKKCTELHGQVTYLQMAGAGLSREQLEYLEAQLAEQ
KEYTKALETQNKELVEMAEKALNDQKEAMEKEWGERLQAVADERDVTTEALKRQGETARSAVLELERKIGAAERTKDDAL
GRLVMSENKADGAEQARARAEERVRECEEEIESLRRKLSSLEQEVDAIRRDGGRRAEELQRQLEERERQVAFLEQSAGVA
EQANTKLRNEMDTLKRQHSTTQCLMRSQVASLAEQMEKDQRVKEDVIAMLTSETEMLQAQAAEATANYKALEAKWTEQTE
RVATLETEKQALEAKWTEQQERVATLETEKKALETMWTEQKDRAATMEGEKKKLEASCERMKEESKLIQEEETRLIRAFS
KTLPEGTSVTLEKILQEKEKQLEESRQRVSALKKDLEESRNECAKALEGLEAEQKNRQAEEKKYKDELEKLRERERQSES
TLQSYISGLQKVQDESMKSREQTERTMKENEEKYAKLSELTAKQHFEREKVLQKHLQEKDALKQSLARMVEETEELQKRY
ENELQHRDDGYRRELEDNQGRLQEMLKEANERADAANKKVKEANEKVKQALSERAALEKSFQAEMENMKKQHQTELTQIR
ESFQKEAEKSKKNLQLQRSLSIDGMKRRHQQELAALRADSQTALSAAKLEYESAAASHEEKLKAAIESVKKEYEEALLKE
TRENEKLKKQHTAEVEKLSQSQVGKIDQHRRQSEHVIEELKKRHAAELEEMKERLAKSTQDYTAMVQELRDKAAKALNDA
QKAHLEEIEKLKSKSKEQEEAHRREIALSMQELQTERGLRGDHSDRFRELLHERITTLQHEIDSLTVKLEDVRDKSAVLE
SEKESLLKVNQELEREKQQMVEERRRTVDDTRRLEKQLVEVQACVSVHEAKATQLAKDLDGKEKKLVELRQEIEKGKSDS
TRKEERLRKAVEAARLVKNEEMKQRDIINSLKKQLEAKEKTLSGLEDEVDHLQEMLRAKDQNDLETLSTLKRRSTELEFD
LQDMKRENAQLKRARETLERERRRTTDVIHNLQEEVRRLAGTAKVNQEDPEKERLRGQLADLERQVEDLEFQLDEHAHAE
ATVRGEAKHFQEESMRKSEEIEKLKKDLSLTRAKVAEANQRMRQSLSDFKKQQEELRSRLARDFARKEEELMAKYQMSRT
HEEEVRSREDDSRIRELEAMIGHLTAAPTALLSTAMIAEVKSFLRHAADTLLTVSAALGDGEAIGELITHMYPMLSAKEV
SQFLLKLVPTTPVSVLESLVERLEPATEAREVWDKMQKATPLLRLSPEAAGLALSIRNHSQGVRSSGVPGSRAPGSVALA
LGRVNGSADTRQQILRFVEVSPPLESLHLLKCVGNVLDPSDVVSLLATLLPAAPHASVASVATALFHDDAPNQIGDALGQ
EFAEFLKEFTYAHHFAVLLPLTGDAIKQIRAIYAVTSNPSTDTRDTAVEAPVVPYGLQSVAAMHHRTPVMPQPAPVVPQP
LPVTPPSDAFAASASAISPVLPQCYATPHAPYLSMYQPPPHSTPQRRRPDEPPAADLGRSVQTVESSRPPGPRMFNLNAK
LSYKLVTQKKTGKKEKASEPVDAPIQRVVSDASTN

Gene-Specific Links for TGME49_044470

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins