ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_044310 ()

developmentally regulated GTP-binding protein 1, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10988

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFE1215c cytosolic preribosomal GTP-binding protein, putative
  • PBANKA_123920 cytosolic preribosomal GTP-binding protein, putative
  • PY06396 GTP-binding-like protein
  • PVX_080030 developmentally regulated GTP-binding protein 1, putative
  • PVX_196290 developmentally regulated GTP-binding protein 1, putative
  • PVX_222290 developmentally regulated GTP-binding protein 1, putative
  • PCHAS_123960 cytosolic preribosomal GTP-binding protein, putative
  • PKH_100780 developmentally regulated GTP-binding protein 1, putative
  • TGME49_044310 developmentally regulated GTP-binding protein 1, putative
  • NCLIV_018880 GTP-binding protein 1, related
  • cgd3_3580 DRG-like OBG family GTpase fused to an RNA binding domain TGS domain, Fun11p
  • Chro.30404 GTP-binding-like protein
  • CMU_016420 small GTP-binding domain-containing protein
  • TP01_0279 developmentally regulated GTP-binding protein 1, putative
  • TA21445 GTP-binding protein, putative
  • BBOV_IV004700 developmentally regulated GTP-binding protein 1, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_044310 developmentally regulated GTP-binding protein 1, putative
MSVLQRIAEVEAEIARTQKNKATNFHLGLLKAKLAKLRAQLIEGSTKKGGGAGGEGFDVSKTGDARVGLVGFPSVGKSTL
LNKLTGTFSEVAAYEFTTLTCVPGVFKYKGAKVQLLDLPGIIEGAKDGKGRGKQVIGVARTCSLILIVLDVMKPITHKQI
IERELEGFGIRLNKKPPNITFKKKDKGGISVTHTVPLNNIDEETIKSICHEYRISNAQIAIRCDATADDIIDVIEGNRLY
IPCLYVMNKIDQITIEELDIISKVPHYIPISAHHEWNLDGLLEKIWQYLDLVRIYTKPKGQIPDYNAPVILNSRMRRVED
FCVRIHKSLLDEFKLAIVWGKSVKHNPQKVGKDHELVDEDVVQIVKK

Gene-Specific Links for TGME49_044310

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins