ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_044200 ()

2-oxoglutarate dehydrogenase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10265

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF08_0045 2-oxoglutarate dehydrogenase E1 component
  • PBANKA_071010 2-oxoglutarate dehydrogenase e1, putative
  • PY02421 2-oxoglutarate dehydrogenase, E1 component
  • PVX_089325 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor, putative
  • PCHAS_071920 2-oxoglutarate dehydrogenase e1, putative
  • PKH_051030 2-oxoglutarate dehydrogenase e1 component, mitochondrial, putative
  • TGME49_044200 2-oxoglutarate dehydrogenase, putative
  • NCLIV_018800 hypothetical protein
  • CMU_035820 2-oxoglutarate dehydrogenase, putative
  • TA05275 2-oxoglutarate dehydrogenase E1 component, putative
  • BBOV_I002070 2-oxoglutarate dehydrogenase E1 component , putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_044200 2-oxoglutarate dehydrogenase, putative
MRSLRSFSTSRWTRGASLSHPTARRSPSASLSLSSSLLSPVVVSARESLLGSSRRSACGASRLLACDFASSRPTSAAALT
GAPLASESFLTGTSAAYVEQMYNAWQRDPSSVHASWNAYFTNVLQDLPAGASFCLPPSAGVSSGLLGSTTAVGGAARGAP
FISSAPGSLPAGASFVTPESLPVSPQQSVHDTSRLIQMVRGYQMRGHEIAAVNPLSLPQETPFVSGSRGPTPAGTLDFEA
YGFTKADLDKVYDCRVDGMCGFLSPEFPPRPLRQIIQRLEEAYCGSVGVEYMHIGDRNVCNFIRQWIETPAKYGFTTDMK
KKILARTARSQMFENFCGQKFSTSKRFGLDGCETMIVAMKAITKKAAREGVNSVVIGMPHRGRLNVLVNVLHKPMQQLLS
EFLGVTSYSSAEWGNSGDVKYHLGVEFDHFDADAQRYIHMGVLANPSHLEAVDPLVIGQARAQQYYSEDEDSTKVLPVIL
HGDASVAGQGVVYETLQMSQLPNYRVGGTIHIVVNNQIGFTTNPVDSSSGRYCTDIAKALDAPVFHVNADDPEAVTFVSE
LALEYRQRFKGDVFIDLIGYRRLGHNELDMPKFTQPRMYNLISKKKSVFDIYSERLLNEGVVTEADLQQLKQNILAFYNA
EYEKCRDFLPSQQYEYSPQWKHLVRPDVPAAPQLTGVPLDRLRELGTKIFTLPPDFNVHPTVGKIYKERLNAIQAAPDEN
LIDFGTAENLCYATLLSDGFHVRIAGQDVQRGTFSHRHAVLHDQTTFEPYSIFDSLKCYGFPHKIQTVNSPLSEYAAMGY
ELGYSLEHPDSLCIWEAQFGDFANGAQIIIDQFIASGEVKWNKQTGIVVMLPHGYDGQGPEHSSGRIERILQLCDDREDV
IHHENWELEKSSIIQQHNLQVIMPSTPANTFHALRRQVHREFRKPLIIFSPKRMLKMRAAMCTLNQLNEGTRFRRYIPDK
TAEPEKVTRLIACSGQVYYDLIAGKDKMKNGDENGDGDKIAIARMEQLSPFPFDLFIEDLKRFPNLKSVVWAQEEPMNQG
AWFYTSKRIESSLRHLNFPNGIRSPIYAGRDVCAATAVGDKKLHDQELAQLLQDALDINRTTHSYLEKYLHKQENK

Gene-Specific Links for TGME49_044200

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins