ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_044030 (IMC3)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
inner membrane complex during tachyzoite

Who localised this protein by microscopy?

Gubbels, M. J., Wieffer, M., Striepen, B.
Fluorescent protein tagging in Toxoplasma gondii: identification of a novel inner membrane complex component conserved among Apicomplexa. (2004 Sep, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

inner membrane complex during tachyzoite
  • "Using this reagent we demonstrated inner membrane complex localization for native IMC3 in wild type RH tachyzoites"
  • Microscopy type: Light
  • Microscopy method: YFP tag, monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from AY615395
  • Localisation record: inner membrane complex during tachyzoite
  • Other genes localised in this publication: splicing factor, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_114633

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_044030 hypothetical protein
MSQSDLFRHGEISAKSQKAGVGFLVSFFRSEEGPHNVNEAEVCAPVEVQSECDDEDFANSLLMDLSSPRKTGDVSSYFPA
DDIVCSVTADSPVDTKHTLAVSHAEEVRAEKTSSRGSVWGSASFFERPQTPPAARDAPRVSSGRAAGTVLQTRRTRIPTG
TPGDASSDGSSPAWRGKQFHVAFQGSKEVTVVEDETASTRSETQDGCQQREGGTWEQAKENSISSSESVARPLTHSAGPY
LRRKGDLQRTVKSGVFLTGALTVPVALVAIACISPWSFGSGLSLLVGGALVFLCGYFGTTLSSRPLLIVYLALLCGLLAS
LLVATVFNTHLAVQAFRAVRHVYFDPSEATTTRRLETAVVSSHSSTSKVTLPLALEIPGRTNMQGMLTNLRKPSFQNLPV
PSATAAYREQRFIEAAEVQQSSKNAKHPRIYDMRHASGDSFDVTGAVGTRFPRAPVAERRLSPLQDSQKNNATPVQTTTE
PVIRVEAERCNAVPLSLTKYIGPTKVQLETYGLLCGFSLYNIWGVVDAWDVDCETFCGFKYLATKRYMWNVGKETLRQGE
SEAVTAGMGPGSAGRVFAFREQKKEATGRTKEHTWSVNRLQEETGKREAHESQPADVARVTSREDALATWRENTSVADQI
KCMELALNLSCGVVRSFYLVLLPGLSVVMVVTSLALFTAGTSLVKKGIQLSQEFAR

Gene-Specific Links for TGME49_044030

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins