ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_043730 (ROP9, p36) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

p36 protein, a gene from Toxoplasma gondii

Compiled localisation
rhoptry during tachyzoite
during not bradyzoite

Who localised this protein by microscopy?

Reichmann, G., Dlugonska, H., Fischer, H. G.
Characterization of TgROP9 (p36), a novel rhoptry protein of Toxoplasma gondii tachyzoites identified by T cell clone. (2002 Jan, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry during tachyzoite, during not bradyzoite
  • "As shown by dual-label immuno-fluorescence analysis, the antigen p36 specifically colocalizes with rhoptry proteins."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: BK
  • Gene model mapping comments: Blast from AJ401616, annotation matches, gene model inconsistent
  • Localisation record: rhoptry during tachyzoite
  • Other genes localised in this publication: -
  • "ROP9 was detectable in the tachyzoite stage of T. gondii but not in bradyzoites."
  • Microscopy type:
  • Microscopy method: antibody directly to protein
  • Strain: DX
  • Gene model mapping comments: inferred from another publication
  • Localisation record: not during bradyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_24477

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_043730 p36 protein
MTHPNPLQTRFSRSASLVSRMPLVRLFFTIAAPLLFSPSPCPFLPLKTHCLAIQLGKPQGSPPASQKEAIRDTGVSHQKG
EPSDSSSEPKPQGTVAETPGAASAAAAEVGRPSRSSAGPGKKKRGPSLFTEETMGPSKRHPCLKTLAAAVERFQAQHLTG
RDAAKAFVDAIQECGIQVVASDYDRTAISVHSGGSARRDDLSVLGALTPDFKLLGEELTRRNIPIYFVTFSDKGENRGDR
IAAGPLVEATLKASNANFEAQGVFGYYPPFYSEPEDYAPLGLSAPMPTDKSFHIQQVSKASGVPEDKILLLDDDRANCVN
FCRSGGAAIHVSGHEGFDFGAVRVVVKPSLIMQ

Gene-Specific Links for TGME49_043730

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins