ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_043710 ()

TCP-1/cpn60 family chaperonin, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11171

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFC0285c T-complex protein beta subunit, putative
  • PBANKA_040520 T-complex protein beta subunit, putative
  • PY06837 putative T-complex protein beta subunit
  • PVX_119465 T-complex protein 1, beta subunit, putative
  • PCHAS_040610 T-complex protein beta subunit, putative
  • PKH_083310 T-complex protein beta subunit, putative
  • TGME49_043710 TCP-1/cpn60 family chaperonin, putative
  • NCLIV_018400 TCP-1/cpn60 family chaperonin, putative
  • cgd6_5080 GroEL-like chaperone (ATpase); T-complex protein 1
  • Chro.60586 TCP-1/cpn60 chaperonin-related protein
  • CMU_021540 T-complex protein 1 beta subunit, putative
  • TA17970 t-complex protein beta subunit, putative
  • BBOV_III000880 T-complex protein beta subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_043710 TCP-1/cpn60 family chaperonin, putative
MISEGGVPDVLQRGAQQDRGETARLQYFVGAIAVGELVKSTLGPKGLDKILTPMQGVEGGRNGRTIITNDGATILKSVWL
DNPAAKILADVALQQDTVCGDGTTGVVVLASELLKQAEELVNQNIHPQIITAGYRKALAVARKRLQEISFGCEDDGLREY
LMKVARTTLSSKLLTHEKEHFAKIAVDAILRLKEHASSLELVHIIKKPGGGLRDSFLDEGFILEKRIGTCQPKVQEDCRV
MVANTPMDTDKIKIYGARVSVDSFEAVQALELAEKEKMKQKVDKIAAYGCNVFINRQLIYNYPEQIFQDHKVIAIEHADF
DGMERLAAALGAEIISTFDAPDPSKLGYCKKMEEIMIGEDKVIRFSGCKRGEACTIVLRGGSEHGLEEAERSLHDALAIL
SQLVLEQKGEKQSGLDTSASLKVDGKVDKASQLANPTGAQPLVVCGGGAAELAMAAAVEELARTEEGKVSLAIEAFAKAL
RQIPTIILENGGLDSADIVSRLRVAHLRGEHTMGVDMDSGSVADMKVKGVLEAYKSKLSQICFAAEAAEMIVRVDDIIRC
APRERSGM

Gene-Specific Links for TGME49_043710

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins