ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_043580 ()

HIT domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10271

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF08_0059 protein kinase c inhibitor-like protein, putative
  • PBANKA_071330 protein kinase c inhibitor-like protein, putative
  • PY05168 putative protein kinase C interacting protein 1
  • PVX_089540 protein kinase C inhibitor, putative
  • PCHAS_072240 protein kinase c inhibitor-like protein, putative
  • PKH_051500 PK8_1820w PK8_1820w Protein kinase c inhibitor- like protein
  • TGME49_043580 HIT domain-containing protein
  • NCLIV_018300 HIT family protein, related
  • cgd1_1600 histidine triad (HIT) family zinc binding protein
  • Chro.10184 hypothetical protein
  • CMU_021270 HIT domain-containing protein
  • TP01_0012 protein kinase C interacting protein 1, putative
  • TA19280 hypothetical protein, conserved
  • BBOV_III011870 HIT domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_043580 HIT domain-containing protein
MLPTRCLKFVTLSTAMLSLQTPRLSAFFSCPLPFRRFNLPFSGPAASDRLSGVSSLRTQEHARRRERALCAFPCSHSKPQ
ASVNRGFSALNFDIPTSFLLTHGACGSRQSTRNVPQRRYQTKRNMATKAQDGHKIVAYDPENVFKKILDGKIPCHKIFET
EHVIAILDAFPAVEGHSLLIPKADVASVFDLDPETAANLYKELPRLCRAVQQATGCEGVNVLQNNGKAAGQVVFHAHVHV
VPRYSGDHLFKQFASAKDMIQPAQAEMVLAKIKAHL

Gene-Specific Links for TGME49_043580

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins