ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_043540 ()

U4/U6 small nuclear ribonucleoprotein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12100

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • MAL13P1.385 RNA binding protein, putative
  • PBANKA_135690 RNA-binding protein, putative
  • PY05621 Homo sapiens RIKEN cDNA 1600015H11 gene-related
  • PVX_083090 WD domain, G-beta repeat domain containing protein
  • PCHAS_136150 RNA-binding protein, putative
  • PKH_121060 hypothetical protein, conserved
  • TGME49_043540 U4/U6 small nuclear ribonucleoprotein, putative
  • NCLIV_018260 U4/U6 small nuclear ribonucleoprotein, putative
  • cgd5_1130 WD-40 repeat protein family / small nuclear ribonucleoprotein Prp4p-related
  • Chro.50272 WD-40 repeat protein family / small nuclear ribonucleoprotein Prp4p-related
  • CMU_040750 U4/U6 small nuclear ribonucleoprotein Prp4, putative
  • TP01_0483 hypothetical protein, conserved
  • TA20625 u4/u6 small nuclear ribonucleoprotein, putative
  • BBOV_I003610 WD domain, G-beta repeat domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_043540 U4/U6 small nuclear ribonucleoprotein, putative
MESASPAGSGQAPGVAKSFHDGPREKSHIYFGPVSAAAPEGVAAVSDVVGEVDASPPDDGEEPAVQKQQELLKRFEVQQK
ASNFQAVCPTHDRTVRKVLRALGHPICLFGEGPFERRQRLKVLFAEGVSLSPEELQNFTLEDESLSRAARVEEASAEDVA
EDELFFTEGTESLLEARRLMFGDSVRRARLRLRQEQQLKRDVPKPLSFKSQAALLLPSASSPSLSPLPKDSVLRRVCQFC
SHLQSQLAVRASQVGDDRPLTCCRFSPGSSRLLRFSSRPDIATKATEEGSEETGEAPLKRVKTERGESDTAEADRRKAAR
EEGVSCLGEKASDLIADPHLQESWGGDSQFLATSSWNEVVKLWSAQEGELLLELRGHTGRVHALAWRDTPEGEAPSDSDK
VEKGGVPLLLASGGADGGICLWDIHRLQPRNCAGLASSAKTSSSNQNSRELLVCKLEGHEDRVNRVAFHPSGRFLASTSH
DETWRLWDVEKQQELLLQEGHAAAVYGVSIHPDGSLIATTDLSGVVRVWDLRTGRTVMPLVGHVKQVVSAAFHPILGNLV
ATASDDHSVKIWDLRKGLSKQSQSSLAGSNHGPHPGSSSHSNKPSSNVVTTVLAHNKLVTEVLFEPVYGRCMYTSSFDGL
VKVWSVNDFACLKTLAAHEGRVMSMDVMKGGETLASVGFDRTWKLWKCGARFCAPRPSTEKTGETAAKSEA

Gene-Specific Links for TGME49_043540

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins