ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_043440 (GCN5-B)

histone acetyltransferase GCN5, putative, a gene from Toxoplasma gondii

Compiled localisation
nucleus during tachyzoite

Who localised this protein by microscopy?

Dixon, S. E., Bhatti, M. M., Uversky, V. N., Dunker, A. K., Sullivan, W. J. Jr
Regions of intrinsic disorder help identify a novel nuclear localization signal in Toxoplasma gondii histone acetyltransferase TgGCN5-B. (2011 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

nucleus
  • "However, the NLS for TgGCN5-A is not conserved in TgGCN5-B, suggesting that TgGCN5-B uses a different NLS to gain access to the Toxoplasma nucleus."
  • Microscopy type: fixed light
  • Microscopy method: FLAG tag
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Nucleus
  • Comment: strain information not found
  • Comment: stage information not found
  • Other genes localised in this publication: AT hook motif-containing protein

Bhatti, M. M., Livingston, M., Mullapudi, N., Sullivan, W. J. Jr
Pair of unusual GCN5 histone acetyltransferases and ADA2 homologues in the protozoan parasite Toxoplasma gondii. (2006 Jan, Eukaryot Cell) PubMed / full text
   more detail about this publication

nucleus during tachyzoite
  • "TgGCN5-B localizes to the parasite nucleus via the N-terminal extension."
  • Microscopy type: Light
  • Microscopy method: FLAG tag
  • Strain: RH
  • Gene model mapping comments: blast from AY875982.1, annotation matches
  • Localisation record: nucleus during tachyzoite
  • Comment: N terminal required for nuclear localisation
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11340

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_043440 histone acetyltransferase GCN5, putative
MAPSECPSDAPGGSGESRVSAEPSSSETPSSAVSSHSPHRAQLSSTQPKNPASPPTSDVSAPHVPLLGAEASGGDPSADP
LGGEGAMERERQAFAEGPGLSARVETALSPQLRTTSGELQQAAADAAVSPDGEKEKEVANSRKGEDSGRLSAFVGRGSRR
SSHAEPAEGPSLPSGADGRLPASGPWASEAPPAGRSASAPVPPVSPGFAFPSVTSCLPLNASIGDIALRLVKEILQPVLA
RDIQVDPPSPFRFTASGMAKALELSPVCFSPAYAASLRKSYAQMGTAGSCFYCVSAPCVCGAFAPPLAQARPAENKKRGR
DACEGPQAEPPVGRGPRRGPNDSGAPVGQDLPGGPQAPGGPGGGFGAGQTFQDNLRQMCLFHPYSSVPPPKLIDMRYLCL
FLSASADSPFACATRTGLCPFFGDGPFGPDGETRNGREGPLARSGDKVEGEKTFLSFVDETADFGDASVEKGFPDHARIG
WEVVEEVAESLEAIFNTIQMETVEDRRDALTVPDEFYAQNYWEWRQFLLDKAPTGASVSRTFGRSLLRSLLLASPGTIAK
DLQRTPISFAAGILFFRLCEEVGIEPETRHVLWRTVASSQPELRSRLVSESGLGFLCRDLGSAKEEEAGLITFKCVTNDR
QPFSSRALVTVKNIFSRQLPKMPREYIVRLVFDRNHYTFCLNKEDTIIGGCCFRPYFQQKFAEIAFLAVTSTEQVKGYGT
RLMNHLKEHVKKSGIEYFLTYADNFAVGYFRKQGFTQKISMPRERWYGYIKDYEGGTLMECHINPRINYLRLSEMLHDQQ
QVIKRATVSLKPLAVYPGLDFWKKNPGQTLSPSQIPGLLQCGWHPGEGAPRAGADGKGISEAERAFLGSTGAPDGAGSAG
VGQGYMRPLHEQIMDILDALGKHHSAWPFLKPVSREEAPDYYDVILQPTDISTMKKKCKKKHYTTAQMFADEVQLMFKNC
RQYNHQQTIYYKYANELDKFVTPKIQALKQAFQQQQKQLAQKGAASGTGVPPLRSPQGGDEGLVGAKHPTFF

Gene-Specific Links for TGME49_043440

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins