ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_042720 (ASP5) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
golgi apparatus during intracellular tachyzoite

Who localised this protein by microscopy?

Shea, M., Jakle, U., Liu, Q., Berry, C., Joiner, K. A., Soldati-Favre, D.
A family of aspartic proteases and a novel, dynamic and cell-cycle-dependent protease localization in the secretory pathway of Toxoplasma gondii. (2007 Aug, Traffic) PubMed / full text
   more detail about this publication

golgi apparatus during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_15516

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_042720 hypothetical protein
MEAGAMGGSSFLSFSSGPSAETSPSSLSPPTSSSPSPSPQLVSDSVESLHAKRPLAQSSRSSSRTAASTCFCWQGEGQEN
EAAPTISQEERRGGSMTAASAGCSECGQHLDPAMDTSRSATGEWIDCKEQERCFGSCSGGTPLGGLGGGGVSSMRRCMYT
QTYSEGSAIRGIYFSDVVALGEVEQKNPPVRYDFVGCHTQETNLFVTQKAAGIFGISFPKGHRQPTLLDVMFGHTNLVDK
KMFSVCISEDGGLLTVGGYEPTLLVAPPESESTPATEALRPVAGESASRRISEKTSPHHAALLTWTSIISHSTYRVPLSG
MEVEGLVLGSGVDDFGNTMVDSGTTYSYFPPAVFSRWRSFLSRFCTPELFCERERDGRPCWRVSPGTDLSSIFPPIKVSF
GDEKNSQVWWWPEGYLYRRTGGYFCDGLDDNKVSASVLGLSFFKNKQVLFDREQDRVGFAAAKCPSFFLDQRPRGPDSGD
GPKGRPTAPFTVPPLRVPVPMDGGGVPGDAKQPEGLPLSPQQLWVAAALVVVAILIAVTVILLHTIKRPSRSSAVVPAPS
APRLPFAQNSKSAGRFARGLGHGALGVGNPVYVQRTQRYREVQEAQPHTADAYYDVEEDRFTGEDDGDFFGDDSVPSAEE
QETAPSLSLREESSPFSASQSTLLDLPLGGE

Gene-Specific Links for TGME49_042720

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins