ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_042290 ()

proteasome subunit alpha type 6, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11086

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • MAL8P1.128 proteasome subunit alpha, putative
  • PBANKA_122310 proteasome subunit alpha, putative
  • PY04190 proteasome subunit alpha Type 6-B
  • PVX_088170 proteasome subunit alpha type 6, putative
  • PCHAS_122370 proteasome subunit alpha, putative
  • PKH_011080 proteasome subunit alpha Type 6-B
  • TGME49_042290 proteasome subunit alpha type 6, putative
  • NCLIV_017470 Proteasome subunit alpha type (EC 3.4.25.1), related
  • cgd3_2170 proteasome subunit alpha1
  • Chro.30254 20S proteasome subunit PAA1
  • Chro.30255 proteasome subunit alpha type 6 (20S proteasome alpha subunit A) (20S proteasome subunit alpha-1) (Proteasome iota subunit)
  • CMU_001360 proteasome subunit alpha type 6, putative
  • TA08070 proteasome subunit (alpha type 6 homologue), putative
  • BBOV_II002330 proteasome subunit alpha type 6 protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_042290 proteasome subunit alpha type 6, putative
MAGRSTQAMYDRHITIFSPDGNLYQVEYAMKAVRNCNLTCVAIKGDDSACLVVQKKVAAHQLTQDKHLDSSFVSSLYTLS
PTIGSCLVGVFPDCRSIAFRARQEAGEFAYKNGYDMPVYALAKRIADINQVYTQFAYMRLHACTGIMISYDEEAGPSIYK
FDPAGFFAGYKACASGTKEQEATNILEKMVKKRSRTTPKEVIECAISAMQHVLAMDFKASDIEVGVVTKDQPAFRILSEH
EVEDHLTSIAERE

Gene-Specific Links for TGME49_042290

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins