ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_040860 ()

1-acyl-sn-glycerol-3-phosphate acyltransferase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10352

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0421 apicoplast 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative
  • PBANKA_130820 apicoplast 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative
  • PY01678 1-acyl-sn-glycerol-3-phosphate acyltransferase (ec 2.3.1.51) (1-agp acyltransferase) (1-agpat) (lysophosphatidic acid acyltransferase) (lpaat). [lyme disease spirochete, putative
  • PVX_118280 hypothetical protein, conserved
  • PCHAS_131140 apicoplast 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative
  • PKH_126200 acyltransferase, putative
  • TGME49_040860 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative
  • TGME49_097640 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative
  • NCLIV_006550 hypothetical protein
  • NCLIV_017010 Lysophosphatidic acid acyltransferase, related
  • cgd8_1400 glycerol-3-phosphate acyltransferase family, possible plant origin, possible signal peptide plus 2 transmembrane domains
  • Chro.80165 hypothetical protein
  • CMU_025330 1-acyl-sn-glycerol-3-phosphate acyltransferase protein, putative
  • TP02_0668 hypothetical protein
  • TA14465 1-acylglycerol-3-phosphate O-acyltransferase, putative
  • BBOV_II006950 acyltransferase family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_040860 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative
MASTPLRVLMTIYFYLVVSVFFLLAFLTELAELVVLLPLMLTIKGLRRRVLSFTFQAYMEMAMFCLPFWRVKFLNRPPRN
YHPRRTIIMCNHASGCDPWVVTSVIFPWPTVFVIKQSLCRVPIAGWCLWLAEYVSVRFTKERGGWGTAPGAVKDCMQKAA
EVLDSGSALVVFPEGTRSVTGRLQPFKDGFFRLAVEQPDVEIFPVGIHGTHKLWPVTSKLVDAGTAYVKYGEPIHAQGMT
VETLKEKTHNEIFECLRASPEFDAQKEQPLTHMASHRGHGL

Gene-Specific Links for TGME49_040860

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins