ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_039740 (GRA14) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
dense granule and intravacuolar network and parasitophorous vacuole membrane

Who localised this protein by microscopy?

Rome, M. E., Beck, J. R., Turetzky, J. M., Webster, P., Bradley, P. J.
Intervacuolar transport and unique topology of GRA14, a novel dense granule protein in Toxoplasma gondii. (2008 Nov, Infect Immun) PubMed / full text
   more detail about this publication

dense granule and intravacuolar network and parasitophorous vacuole membrane
  • "indicating that 49.m03169 is a novel dense granule protein (GRA14)."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RH delta hpt
  • Gene model mapping comments: Blast from FJ015061.1, gene model inconsistent
  • Localisation record: dense granule
  • Comment: couldn't find parasite stage information
  • Other genes localised in this publication: -
  • "Epitope-tagged GRA14 traffics to the PV and localizes to the IVN and PVM"
  • Microscopy type: Light
  • Microscopy method: C terminal HA tag
  • Strain: RH delta hpt
  • Gene model mapping comments: inferred from another publication
  • Localisation record: intravacuolar network, PV membrane
  • Comment: couldn't find parasite stage information
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_114566

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_039740 hypothetical protein
MQAIARGDRSSGWSSCSWLFYFSFLLLTSEAVAAAASLEQTISYSVQHQPQQEGILGTQKPQTAPTPQQLIVPVSYLGDG
LSYFSGVLRRLPLDVALERLTSAREIPTVAGFVQKYVLAAQLSRSLQSTANGVKKILMRLDAAKNEEGFITDLLKSAPEV
QEVLSRFLGSVASALALLDINGLHEAVDASLPVTKAVVMLYLHLVSVVPPKQRDPFSPFLLYLQDAVGEFKIMEDHVASV
VAGEAQEENVINSQPQGTETSHRAVVRGGIRMLQSGTSETTKLRRTWWRLFKVAALAVLTMALLKYGTPRVRAFLERRRM
RRGGGGDSGDFGEEGRSKGDVSTSDDMPREPPPPYVPPMYPFAEPEHRWAGTYGTSHGGYRVQPTAPPAPASMLYPSLHR
LGYQRPSE

Gene-Specific Links for TGME49_039740

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins