ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_039490 ()

mitochondrial branched-chain alpha-keto acid dehydrogenase E1, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11553

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF13_0070 branched-chain alpha keto-acid dehydrogenase, putative
  • PBANKA_141110 branched-chain alpha keto-acid dehydrogenase, putative
  • PY05086 branched-chain alpha-keto acid dehydrogenase E1-alpha subunit
  • PVX_122460 2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial, putative
  • PCHAS_141300 branched-chain alpha keto-acid dehydrogenase, putative
  • PKH_141180 branched-chain alpha keto-acid dehydrogenase, putative
  • TGME49_039490 mitochondrial branched-chain alpha-keto acid dehydrogenase E1, putative
  • TGME49_092100 2-oxoisovalerate dehydrogenase, putative
  • NCLIV_012850 hypothetical protein
  • NCLIV_016110 hypothetical protein
  • TA10340 branched-chain alpha-keto acid dehydrogenase E1, subunit, putative
  • BBOV_III008200 dehydrogenase E1 component family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_039490 mitochondrial branched-chain alpha-keto acid dehydrogenase E1, putative
MAHTASSFFRRLLQPAGASRLFSAPVVGQHPVSLLKSSSVYAQKSASRLFSAGVRTFSSAAAGPREEAYHAGLIHTQFTT
DMNISNETPVIPIFRILDYDGQIADGWQCPMTNDEVLEAYQFMVKLSIWDNMFYSVQRQGRISFYIQNQGEEALQTAVGL
ALDKKDHLFCQYRELGVLMLHGFTAEDALEQLFARRGDESKGRQMPISYSKHSVNLHTICTPLTTQVPHAAGAGYAFKLA
GDDRIAVAFFGEGAASEGDFHAAMNFAATLKSQTLFVCRNNGYAISTPVKDQYAGDGIAIRGISYGMHTIRVDGNDLFAS
LLATKKAREIIVSQRQPVLIEFMTYRVGHHSTSDDSFQYRPSGELEAWGQSGIHPIARVRRYLDNLNLWSDKQDEELRKD
ARATMLRMMKVVEKDKRSAVIGGIFDDVYDKEPWNLREQRESLKAFMEKNKQHYPQLKEYESL

Gene-Specific Links for TGME49_039490

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins