ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_039260 (H4, acetylated histone H4)

histone H4, putative, a gene from Toxoplasma gondii

Compiled localisation
nucleus during intracellular tachyzoite and tachyzoite
not cytoplasm during intracellular tachyzoite

Who localised this protein by microscopy?

Braun, L., Cannella, D., Ortet, P., Barakat, M., Sautel, C. F., Kieffer, S., Garin, J., Bastien, O., Voinnet, O., Hakimi, M. A.
A complex small RNA repertoire is generated by a plant/fungal-like machinery and effected by a metazoan-like Argonaute in the single-cell human parasite Toxoplasma gondii. (2010 May, PLoS Pathog) PubMed / full text
   more detail about this publication

nucleus during tachyzoite
  • "Using acetylated histone H4 as a marker, confocal analyses also revealed a faint nuclear staining indicating that a minor portion of Tg-AGO localizes to the nucleus."
  • Microscopy type: light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: nucleus during tachyzoite
  • Other genes localised in this publication: piwi-PAZ domain-containing protein

Jan, G., Delorme, V., Saksouk, N., Abrivard, M., Gonzalez, V., Cayla, X., Hakimi, M. A., Tardieux, I.
A Toxoplasma type 2C serine-threonine phosphatase is involved in parasite growth in the mammalian host cell. (2009 Oct, Microbes Infect) PubMed / full text
   more detail about this publication

nucleus and not cytoplasm during intracellular tachyzoite
  • "As expected, anti-HA antibodies only stained the tachyzoite cytoplasm (red) (Fig. 2B) while an anti-acetylated histone H4 (acH4) antibody exclusively labelled the nucleus (green), and no overlap can be observed between the two dyes (Fig. S1B)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody to homologue
  • Strain: RH HXGPRT
  • Gene model mapping comments: inferred from another publication
  • Localisation record: nucleus and not cytoplasm during intracellular tachyzoite
  • Other genes localised in this publication: serine-threonine phosophatase 2C, Rhoptry kinase family protein ROP2A (incomplete catalytic triad)

Gissot, M., Kelly, K. A., Ajioka, J. W., Greally, J. M., Kim, K.
Epigenomic modifications predict active promoters and gene structure in Toxoplasma gondii. (2007 Jun, PLoS Pathog) PubMed / full text
   more detail about this publication

nucleus during intracellular tachyzoite
  • "Commercial antibodies (FITC; green) specific for histone modifications H3K4me3 (SF2A), H3K9ac (SF2B), and H4ac (SF2C) label the nucleus of the parasite (DAPI; blue)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: annotation search on ToxoDB
  • Localisation record: Nucleus during intracellular tachyzoite
  • Other genes localised in this publication: histone H3

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10043

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_039260 histone H4, putative
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEEIRGVLKVFLENIIKDSVTYTEHARRK
TVTAMDIVYSLKRQGRTLYGFGG

Gene-Specific Links for TGME49_039260

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins