ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_037150 ()

signal peptide peptidase domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11689

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_132070 signal peptide peptidase, putative
  • PY06507 Homo sapiens dJ324O17.1.2-related
  • PVX_117615 signal peptide peptidase domain containing protein
  • PCHAS_132400 signal peptide peptidase, putative
  • PKH_124910 signal peptide peptidase, putative
  • TGME49_037150 signal peptide peptidase domain-containing protein
  • NCLIV_051010 signal peptide peptidase domain-containing protein, putative
  • cgd6_840 shanti/Ykl100cp/Minor histocompatibility antigen H13-like; presenilin, signal peptide peptidase family, with 10 transmembrane domains and a signal peptide
  • Chro.60109 multi-pass transmembrane protein
  • CMU_027390 signal peptide peptidase family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_037150 signal peptide peptidase domain-containing protein
MGRTEAAAAAAAPQAHKSERRLFYGCFALLGATMAVSHFLALPVLLQMVVYTFPIVYIGSHASLRQNEVDEVTGEKSNKG
EAMNHTDAMLFPVFGSVALFSLYVAYKFLDASWVNFLLTLYLTAIGLLALGETLHVALFPLFPDWAKDESRLAFKLCLPH
IPVLYPRPSLETESEREAYEASCMHRFSYSQLAAYLVAAALSALWLWKKHWALHNLLGIAFCIQAISLVSVGNFTVATIL
LSGLFIYDIFWVFGTDVMVTVAKSFEGPAKLIFPVSIHPWQHSILGLGDIVIPGVFISMCLRFDYSLATASVTNGNAAKT
TTVGASIDIHQKFSKFYFFVVSIFYEFGLLTTGVIMLVFQHPQPALLYIVPFCLFSLFGAAALNGQVKEVLAYREDEEEK
PAEVEGESEMKEEKKRK

Gene-Specific Links for TGME49_037150

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins