ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_036970 ()

SNF2 family N-terminal domain containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_22411

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_112350 SNF2 helicase, putative
  • PY05642 SNF2 family N-terminal domain, putative
  • PY06148 Helicase conserved C-terminal domain, putative
  • PVX_114340 SNF2 family N-terminal domain containing protein
  • PCHAS_112300 SNF2 helicase, putative,Smarca-related protein, putative
  • PKH_112490 SNF2 helicase, putative
  • TGME49_036970 SNF2 family N-terminal domain containing protein
  • NCLIV_050870 SNF2 family N-terminal domain containing protein, putative
  • cgd8_4620 ISWI related chromatinic protein with an apicomplexan specific domain architecture composed of 3x PHD+SNF2 ATpase+2xPHD
  • Chro.80533 SNF2 family N-terminal domain
  • CMU_041990 SNF2 family N-terminal domain-containing protein
  • TA10885 SWI/SNF-related chromatin remodelling factor (ISWI homologue), putative
  • BBOV_III006940 SNF2 family N-terminal domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_036970 SNF2 family N-terminal domain containing protein
MGSQGVRSGSASRSGSGENSRSSSCARDASSSPPRSTFNSPRLRAQAERQAAAQAEAVASSSSMPRNGCQSSVAAGVSSG
RSTKFSGSFFSQASSSGAGRSKRGGMWCYICRDSMQRGEENTVECTACPKRFHMECLQQEGVIQPGERVAADDWMCPQCL
EEHEEDEIQNDERCFICKRKEPEDEEEDRLLMCDGCPNSYHMRSCLKLTIEPDEEKWFCPECNPSGFKQDEIRRLGRGRA
GAGTTEGRGEIVNSSTCYVCQRPGKLLGCDFCVNSFHPTCLVDVDWDAIGEEWECPVCKGHDPLANQMHKRWSRAEIDAK
RKERIKCLERIRVKTTRYRNRFLLVNQKDLGPFVNQKVLNNLAKSFRAQMNANASGRRRGPQAQCGRLQVERSIQDLLES
LEDEAAEESAKFVKRAYRACRHPSGRKIEGVPLREGIALKPHQEEGVEWLLRSFMTGGGILADEMGLGKTIQTLCFLSYL
NAMKLEGPHLIVVPLSTVGNWMREVHRFTPSLTHIKICGSRAERQHAMEDRLAQKGLYDLYITTYETVKSEEEFFVETIP
HWQCIVLDEAHRIKNASGAIRHALDRVIGNMRLLLTGTPLQNNAAELFTLINFLMPDVFRDSQVIEQAFLANPQGGGAGA
QAATKRDTASGRGDNISPKSQNGKKAPVVEVDQLFRQEDLEAIRNLLDRVMLRRLKEQAIALPKKLYHSVWVPLSAPAAS
WLERLLRVRALQEAGKDKLNTSSYRKMLGLVIKMRIICAHPKALCARESQMQRLQAFFVEENAEMQTEVIEAARKIQRIE
GEAHILCSAKLTFLDKLMRHLHELNCKYVPRYEKDYENHRRETATYKFYKHHEERVKEETAAGRKPPRRPKRNELGGIEE
FQRLLRAGHPRLAGVPTVEDPDFLEEGMYPAEFQLPQPVESSVRGADGLGLLGRRRASGDEGVDMENGRDRGKVSSSSEG
ADMAEGKHGASQSSRGPHDGTGKRKVIDDEDDQDEGDAVKSRDAARTKKKRGLVILDEDDDMGTVTAVSSSSPVPIASSM
TSSTAATSPAAEDASSGARRSSSSEHSDELRPPPTPGEGASTAASVVKSEDAVPNGLQASPRGLCASPRAGDEALSTTCC
TSTPSSTKDNGRRSGRSSDGTQPAYPVKKEEGEQVGGAKAEVSKEETEETKVEVKVETQERTEGAEQQRNGKGEAVAFGN
EKQEFVIDRSQPKAQRLLVFTQFQLVLDELEAYCHYRGWKYLRLDGSTNKFVRELDIRDFNSENSTYFVYLISTRAGGLG
INLTSANHVVLYDHDWNPFIDLQAIDRAHRIGQQRAVHVWSLVNEWTVEERMAFRREQKLRLDKLLVQNQQEEALDDEDE
EQQKGGDKISTDEIRKLMLHGRKAIVEVAAKNPVSIAECSLEELTDRQRLPLPELMDGEGNGDSALLDSSRITTNEDGDD
DELGSRDGENMVDIDEVMNEEAEEQNKRFQLLESADSVSPDTGSVEMGVAGCGGSTGGPQDSPEGSKTTSENETAFAREI
ERAREGEEGRTPTGDQAVPSPAEGENDASRGSGTGRTKGKLENELQRAGVLWRSERERKKPIAVYVPQEFGQREERKKIK
HESKCFLCGNGKDFEHTSVDADGNTTKVSLGDLVYCSGCPRSYHRVCEGLPRDVKKSWRCRWHECCLCFRKTSQCGNMLI
HCAKCPTSFCYDCFPPDYCRHNVSEEYYSYLRQRGMNVTPQNWILLLCSRCKAVEEQQTRRRLTKEEKEQEKLQQKELRQ
QQKELHHDLDASKRKQENQQRRQECRQRAEEERQFQEAKQQIDSQDAKQEEELRQAYQHLFPAAFTEELHKRVSAAKSAQ
KASRDASVAVQAQVAAAAAARAVAVSVVSAAASGSQPAVSGSLDEQQQRSLQAAAAAAQQAALNAKKAQQQTKRPVNQLA
NMKLPGASIALCENCHFPCHGVRDYPAPCCFPAEVQSRFFVRCTPGGTTKTSGCYSPLGDNSKASQIHTGNDSDQGSLSA
SPDALQLREGEEEAGTSHGQKRDEDYGAEITTGDGQQRSPSDRENGPGTASPGAALLPAGRGRGGAGTPMTPEVPAALAE
KLGLSVEALTSGVDAATAAQITAAGGASDQVRFVHRQVCGCCGECRTGRRGHLRKHCPNLPAEEKKKYVERREKMQQLIQ
KLMQHPPIPDTSNVNGYAGASPQRLKWYFQQYQQQADRIVEETMIVLGLQAAVAPRTFGQRRSAGGGSSGLPSGSPAGSF
PRSPGTASQLVLHQQGGGLPVVEGAATGGRKRNVDSGHATPGGAGMKKQPAGRRPSASPKSAGRESSTGGSDVEVVGVGR
TNQSSGGEKGSRSQAGKGAGGEGKAGRGNKLPATNPWNTGPHTSCNSLASATTTKEGGLTPKTLLKGVDSAVQSGFAGAC
TANAPFAGPGFKRALGDGKSNRSGGDTTAPGGSTDSSPSSGAPPQKRRKPASPKGLVGTESGTSGGKRGAEGSSLLSGAT
TGASSSGNSGGTGLSAVAPVKQQQSILEFFCARNTKSGGNITAAGGPMAVLAALAAAKQRAAGGGSVAGAGGKTVP

Gene-Specific Links for TGME49_036970

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins