ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_036210 ()

mitochondrial-processing peptidase beta subunit, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10524

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFI1625c organelle processing peptidase, putative
  • PBANKA_083440 organelle processing peptidase, putative
  • PY01832 mitochondrial processing peptidase beta subunit
  • PVX_087035 organelle processing peptidase, putative
  • PCHAS_083470 organelle processing peptidase, putative
  • PKH_073170 organelle processing peptidase, putative
  • TGME49_036210 mitochondrial-processing peptidase beta subunit, putative
  • NCLIV_050470 hypothetical protein
  • cgd5_3400 mitochondrial processing peptidase beta subunit
  • Chro.50031 mitochondrial processing peptidase beta subunit
  • CMU_015750 insulinase, putative
  • TP01_0151 biquinol-cytochrome C reductase complex core protein I, mitochondrial precursor, putative
  • TA19130 mitochondrial processing peptidase, putative
  • BBOV_IV001260 mitochondrial processing peptidase beta subunit
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_036210 mitochondrial-processing peptidase beta subunit, putative
MMFRFLPRVASGASSLSVSQRRLRASFSSSLQSRGFFSAAPAAATAGVSPLARSVDAAIPEEAFNQPPTLTTTLPNGIRV
ATQRLPFHQTATVGVWIDSGSRYDTKETNGAAHFLEHMTFKGTKRRSRIQLEQEIENMGAHLNAYTSREQTVYYAKAFKK
DIPQCVDILSDILLNSTIDEEAVQMEKHVILREMEEVERQTEEVIFDRLHTTAFRDSPLGYTILGPEENIRNMTREHILE
YINRNYTSDRMVVAAAGDVDHKELTALVEKHFAGLPQPKRSKIILPTEKPFFCGSELLHRNDDMGPTAHVAVGFEGVPWK
SPDAVTFMLMQAIVGSYRKHDEGIVPGKVSANATVRNVCNKMTVGCADMFSAFNTCYSDTGLFGFYAQCDEVALEHCVME
IMFGITSLSYAVTDEEVERAKAQLKTQLLGHLDSTTAVAEDIGRQMLAYGRRMPLAEFLKRLEVIDAEEVKRVAWKYLHD
AVRPKVGALGSRKEELRKGETERLEGESGEKKKRDSLTRQMRDS

Gene-Specific Links for TGME49_036210

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins