ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_036040 (Aldolase I, aldolase, aldolase-1)

fructose-1,6-bisphosphate aldolase, a gene from Toxoplasma gondii

Compiled localisation
cytosol during intracellular tachyzoite
cytoplasm during intracellular tachyzoite after 0.5-4 hours
cytoplasmic face of inner membrane complex during extracellular tachyzoite and intracellular tachyzoite until 0.5-4 hours
nowhere except cytoplasmic face of inner membrane complex during extracellular tachyzoite and intracellular tachyzoite until 0.5-4 hours
not inner membrane complex during immature daughter tachyzoites
apical during tachyzoite
conoid during tachyzoite gliding motility

Who localised this protein by microscopy?

Pomel, S., Luk, F. C., Beckers, C. J.
Host cell egress and invasion induce marked relocations of glycolytic enzymes in Toxoplasma gondii tachyzoites. (2008 Oct, PLoS Pathog) PubMed / full text
   more detail about this publication

cytoplasm during intracellular tachyzoite after 0.5-4 hours, cytoplasmic face of inner membrane complex during extracellular tachyzoite and intracellular tachyzoite until 0.5-4 hours, nowhere except cytoplasmic face of inner membrane complex during extracellular tachyzoite and intracellular tachyzoite until 0.5-4 hours, not inner membrane complex during immature daughter tachyzoites
  • "When we used our affinity-purified antibodies to Toxoplasma aldolase-1 to localize this enzyme in intracellular parasites, we found it to be distributed throughout the parasites' cytoplasm (Figure 3A and Figure 4), irrespective of the fixation conditions used. In extracellular parasites, on the other hand, the protein localized to the parasite periphery (Figure 3A, C) where it overlapped with IMC1, a membrane skeleton protein of the Toxoplasma IMC"
  • Microscopy type: Light
  • Microscopy method: c terminal myc tag, antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: throughout cytoplasm during intracellular tachyzoite after 0.5-4 hours, cytoplasmic face of IMC and nowhere except cytoplasmic face of IMC during extracellular tachyzoite and intracellular tachyzoite until 0.5-4 hours, not IMC during immature daughter tachyzoites
  • Comment: Some coloc with IMC1 during extracellular
  • Other genes localised in this publication: hexokinase, membrane skeletal protein IMC1, glyceraldehyde-3-phosphate dehydrogenase, facilitative glucose transporter, putative, pyruvate kinase, putative, lactate dehydrogenase
  • "When we used our affinity-purified antibodies to Toxoplasma aldolase-1 to localize this enzyme in intracellular parasites, we found it to be distributed throughout the parasites' cytoplasm (Figure 3A and Figure 4), irrespective of the fixation conditions used. In extracellular parasites, on the other hand, the protein localized to the parasite periphery"
  • Microscopy type: Light, EM
  • Microscopy method: antibody directly to protein
  • Strain:
  • Gene model mapping comments: blast from AY150663
  • Localisation record: throughout cytoplasm during intracellular tachyzoite after 0.5-4 hours, nowhere except cytoplasmic face of IMC during extracellular tachyzoite and intracellular tachyzoite until 0.5-4 hours, not IMC during immature daughter tachyzoites
  • Comment: The Toxoplasma genome contains two potential aldolase-encoding sequences, but only one of these, aldolase-1, is expressed in Toxoplasma tachyzoites and the second appears to represent a pseudogene ([7], data not shown).
  • Comment: Some coloc with IMC1 during extracellular
  • Other genes localised in this publication: hexokinase, membrane skeletal protein IMC1, glyceraldehyde-3-phosphate dehydrogenase, facilitative glucose transporter, putative, pyruvate kinase, putative, lactate dehydrogenase

Fleige, T., Fischer, K., Ferguson, D. J., Gross, U., Bohne, W.
Carbohydrate metabolism in the Toxoplasma gondii apicoplast: localization of three glycolytic isoenzymes, the single pyruvate dehydrogenase complex, and a plastid phosphate translocator. (2007 Jun, Eukaryot Cell) PubMed / full text
   more detail about this publication

cytosol during intracellular tachyzoite

Jewett, T. J., Sibley, L. D.
Aldolase forms a bridge between cell surface adhesins and the actin cytoskeleton in apicomplexan parasites. (2003 Apr, Mol Cell) PubMed / full text
   more detail about this publication

apical during tachyzoite, conoid during tachyzoite gliding motility
  • "Toxoplasma gondii Aldolase Is Apically Localized and Partially Relocalized during Gliding Motility...In gliding parasites where MIC2 had translocated toward the posterior end of the cell, a portion of the cellular aldolase was also redistributed from its normal apical location"
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain:
  • Gene model mapping comments: blast from AY150663
  • Localisation record: apical during tachyzoite, conoid during tachyzoite gliding motility
  • Comment: The Toxoplasma genome contains two potential aldolase-encoding sequences, but only one of these, aldolase-1, is expressed in Toxoplasma tachyzoites and the second appears to represent a pseudogene ([7], data not shown).
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10632

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_130860 fructose-bisphosphate aldolase 2
  • PY03709 Fructose-bisphosphate aldolase class-I
  • PVX_118255 fructose 1,6-bisphosphate aldolase, putative
  • PCHAS_131180 fructose-bisphosphate aldolase, putative
  • PKH_126150 fructose-bisphosphate aldolase, putative
  • TGME49_036050 fructose-bisphosphate aldolase, putative
  • NCLIV_050380 Fructose-bisphosphate aldolase (EC 4.1.2.13), related
  • cgd1_3020 fructose-1,6-bisphosphate aldolase
  • Chro.10335 fructose-1,6-bisphosphate aldolase
  • CMU_029810 fructose-1,6-bisphosphate aldolase, putative
  • TP01_0101 fructose-bisphosphate aldolase, putative
  • TA20060 fructose-bisphosphate aldolase 2, putative
  • BBOV_IV000790 fructose-1,6-bisphosphate aldolase
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_036040 fructose-1,6-bisphosphate aldolase
MLCIVERIAMPTRGVNPSAANGKLPPRTRSATGCRVYIHPMVKFISLLFAVFYARFFLLFCVRIQSTFPTMSGYGLPISQ
EVAKELAENARKIAAPGKGILAADESTGTIKKRFDSIGVENTEANRAFYRDLLFSTKGLGQYISGAILFEETLYQKSPSG
VPMVDLLKAEGIIPGIKVDKGLETLPLTDDEKATMGLDGLSERCKKYYEAGARFAKWRAVLSIDPAKGKPTNLSITEVAH
GLARYAAICQANRLVPIVEPEILTDGSHDITVCAEVTERVLAAVFKALNDHHVLLEGALLKPNMVTHGSDCPKPASHEEI
AFYTVRSLKRTVPPALPGVMFLSGGQSEEDASLNLNEMNKMGPHPFQLSFSYGRALQASCLKAWKGVPENKAKAQQVLME
RARANGEAQLGKYGGGAGGAAAASSLFEKRYVY

Gene-Specific Links for TGME49_036040

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins