ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_035970 ()

eukaryotic translation initiation factor 2 gamma subunit, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10922

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0104 eukaryotic translation initiation factor 2 gamma subunit, putative
  • PBANKA_103190 eukaryotic translation initiation factor 2 gamma subunit, putative
  • PY04028 translation initiation factor eIF-2
  • PVX_085920 eukaryotic translation initiation factor 2 gamma subunit, putative
  • PCHAS_103270 eukaryotic translation initiation factor 2 gamma subunit, putative
  • PKH_133710 eukaryotic translation initiation factor
  • TGME49_035970 eukaryotic translation initiation factor 2 gamma subunit, putative
  • NCLIV_050300 GH18750, related
  • cgd3_1650 eIF2G GTpase. eukaryotic translation initiation factor 2 gamma subunit (ZnR+GTpase)
  • Chro.30199 translation initiation factor eIF-2
  • CMU_043310 eukaryotic translation initiation factor 2, gamma subunit, putative
  • TP01_0335 eukaryotic translation initiation factor 2 gamma subunit, putative
  • TA21190 eukaryotic translation initiation factor 2 gamma subunit, putative
  • BBOV_IV004190 translation initiation factor 2 gamma subunit , putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_035970 eukaryotic translation initiation factor 2 gamma subunit, putative
MANATTDHLRPQDLETLDISKLTPLSPDVISRQATINFGTIGHVAHGKSTIVRAVSGVQTVRFKHEKERNITIKLGYANA
KIYKCSNPECPEPECYKSYGSSKEDEPPCPRPGCGHKMKLLRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNEPCP
QPQTSEHLAAVEIMRLQHIIILQNKVELIKESQAQQQQEEIRAFVAGTAADKAPIIPVSAVLKFNIDILCQYICTLVPVP
VRDFTSPPQMIIIRSFDVNKPGEEATNLQGGVAGGSISQGVLKVGDDIEVRPGIISKDSAGNIQCRPIVSTIMSMFAEEN
PLKYAVPGGLIGVGTNIDPTLTRADRLVGQVLGHPGNLPDCFGEMEVSYYLLRRLLGVRSQEGDKSTKVSKLKKGEFLMV
NIASTSVGARVAGLKPEMAKLELTGPVCTRVGDKIALSRRVDKHWRLIGWGQIHKGKTLPLLESL

Gene-Specific Links for TGME49_035970

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins