ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_035700 ()

sedoheptulose-1,7 bisphosphatase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_18798

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • TGME49_035700 sedoheptulose-1,7 bisphosphatase, putative
  • NCLIV_050070 Fructose-1,6-bisphosphatase (EC 3.1.3.11), related
  • NCLIV_050080 Fructose-1,6-bisphosphatase class 1 (EC 3.1.3.11), related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_035700 sedoheptulose-1,7 bisphosphatase, putative
MESPSALPSLDQLLKEQGADQTLTDLILAILDRCGKIASALQGTSVDKVGSVNEFGDEQLTVDVIAENLLRSWAQSSEGS
AVRAVCSEEDIHLQECHKNGEFILCWDPLDGSSIIDCNWAVGSIVSIWRIGHHGVQWQGADTLIQKTGRQQVASLIVVYG
PRTTGVVAVNVDAGGIVKEGTALDLEMKDNGKFICRGKPIIKPQAKIFSPANLRAAQDLPAYKQLIEFWMEKRYTLRYTG
GLVPDVYQIFVKQQGVFCNPASKAAPAKLRMCFEVLAIALVVEAAGGRTSNGQKSLLDVAIEHMDHRSALCCGSADEIKR
MEETFAALSG

Gene-Specific Links for TGME49_035700

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins