ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_035470 (MyoA)

myosin A, putative, a gene from Toxoplasma gondii

Compiled localisation
inner membrane complex

Who localised this protein by microscopy?

Gaskins, E., Gilk, S., DeVore, N., Mann, T., Ward, G., Beckers, C.
Identification of the membrane receptor of a class XIV myosin in Toxoplasma gondii. (2004 May 10, J Cell Biol) PubMed / full text
   more detail about this publication

inner membrane complex

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10145

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_035470 myosin A, putative
MASKTTSEELKTATALKKRSSDVHAVDHSGNVYKGFQIWTDLAPSVKEEPDLMFAKCIVQAGTDKGNLTCVQIDPPGFDE
PFEVPQANAWNVNSLIDPMTYGDIGMLPHTNIPCVLDFLKVRFMKNQIYTTADPLVVAINPFRDLGNTTLDWIVRYRDTF
DLSKLAPHVFYTARRALDNLHAVNKSQTIIVSGESGAGKTEATKQIMRYFAAAKTGSMDLRIQNAIMAANPVLEAFGNAK
TIRNNNSSRFGRFMQLDVGREGGIKFGSVVAFLLEKSRVLTQDEQERSYHIFYQMCKGADAAMKERFHILPLSEYKYINP
LCLDAPGIDDVAEFHEVCESFRSMNLTEDEVASVWSIVSGVLLLGNVEVTATKDGGIDDAAAIEGKNLEVFKKACGLLFL
DAERIREELTGKVSYAGNQEIRGRWKQEDGDMLKSSLAKAMYDKLFMWIIAVLNRSIKPPGGFKIFMGMLDIFGFEVFKN
NSLEQFFINITNEMLQKNFVDIVFDRESKLYRDEGVSSKELIFTSNAEVIKILTAKNNSVLAALEDQCLAPGGSDEKFLS
TCKNALKGTTKFKPAKVSPNINFLISHTVGDIQYNAEGFLFKNKDVLRAEIMEIVQQSKNPVVAQLFAGIVMEKGKMAKG
QLIGSQFLSQLQSLMELINSTEPHFIRCIKPNDTKKPLDWVPSKMLIQLHALSVLEALQLRQLGYSYRRPFKEFLFQFKF
IDLSVSENPNLDPKEAALRLLKSSKLPSEEYQLGKTMVFLKQTGAKELTQIQRECLSSWEPLVSVLEAYYAGRRHKKQLL
KKTPFIIRAQAHIRRHLVDNNVSPATVQPAF

Gene-Specific Links for TGME49_035470

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins