ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_035170 ()

replication factor C subunit, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10913

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFB0895c replication factor C subunit 1, putative
  • PBANKA_031600 replication factor C subunit 1, putative
  • PY04496 replication factor C, 140 kDa subunit
  • PVX_002575 replication factor C subunit 1, putative
  • PCHAS_031810 replication factor C subunit 1, putative
  • PKH_040080 replication factor C subunit 1, putative
  • TGME49_035170 replication factor C subunit, putative
  • NCLIV_049750 replication factor c subunit, putative
  • cgd8_610 DNA replication repC1, AAA+ ATpase with a BRCT domain at the N-terminus
  • Chro.80076 replication factor C subunit 1
  • CMU_024550 replication factor C subunit protein, putative
  • TA18630 replication factor c-related protein, putative
  • BBOV_III002070 conserved hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_035170 replication factor C subunit, putative
MDRKRGDIRAFFKPKVPPPSASAAKETRRSVSTPEDPVPSQGAVRPGGSKQEEKIVNPGDWTGRKEPVAQQPAKPVQATD
PGYERADDVANQPVQLSSHGDSPDRIPKTSSMSQGRGKGGRLRRIASSDDEDSSPRHSSCLRAGAPPPGSSLGKKVSPAV
EVKRRPQNERGERREDAKSRCKSKDVKQKAVEVVDVDDFLSSSVDKAVEKVLTRPPQKPTQSLQTEEMDVDEEDEEQEEK
AKERGEEEAKRSSCPGRLDRVASSPKGKRPANTTSQWTKLVRSMEPEQVRQKRKKMEARQSPEVLSNSEEEMHARPRRPR
QKDDEEEEYVESSEEDEESEDDDADESEEEDTNGSLKAKGRSKSHKEVQNPPSTAIARSPTAPSPSSARSWQAQQQKPEA
MPAPAQLSSTGKRMYTSNLEEGSEQTSTCSPSPNRKKRKVEESVVPLTKKDKEEGSTNPLAGSTSCFAGKTFVFTGVLDS
MAREEAVSAVVGNGGRCTSAVSGRTDYLVAGALLEDGRDVTTGSKYRKALQLMHDGKGKQKTSLKILHEQEFLAMLPENA
EKKPTLEARQLQEETSRLESAKTVKSDGSADEPDRHHSDENSGTLLWAEKYRPKRADDVVGNREHLRTLQTWLADWADVC
LHGIKKKPPPRSSAPSFSPYGFAPTINLNARAALLSGPPGIGKTTAARLAAEAAGYDVLEYNASDARNKAHIEDIGNMTS
GGLTLHSFLDQKNEASRGSPGRNAKRPMGACVLMDEVDGLSGGDRGGAQAIVKLIETSKCPIICICNDRMHPKVRTIASK
CLDLRFHPPHMAALRSRVEKIAAAEDLSLDPQAVDYLCESAGGDLRQILTSLQMIAYETREKAKEKDWKSREEKADFSTG
LKDEQVMHGPFECCKQLLDAHQSSKLSRRQKLDKFFSDYDLIPLLIQENYLEAFRQGMQRGSSPSAEKFSSPHTFSMTKK
TSLSSASSRVGVSTQPNDCFVINLVASAACDLVEADIMNNVLRVSQQWGMLPDIGFLCCVSLPAKVEKAQGFLGRVQFPS
WLGRNSTQTKHKRLLTELLLVLLNQLQCCSTSSGLKLSGYLDALYRKCVGPLVRLSKADPKIAVEAAMQAMAEYSLTRGM
VVDNLNSLRLKNQERLYDSIETRVKSSFTRMCNAAAKASSAFIVEARKGRNAKAAAAEEERQDGEQDMEVTTTGEDNVDA
ADEDDDDPLRDSFILSAVKGKKEMKGAAGRSQRGGGPRSTPRGESNAARRGKKVRSKAAT

Gene-Specific Links for TGME49_035170

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins