ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_034570 (HAD-2SCP-2)

peroxisomal multifunctional enzyme type 2, putative, a gene from Toxoplasma gondii

Compiled localisation
anterior vesicle and cytosol and posterior vesicle during intracellular tachyzoite

Who localised this protein by microscopy?

Lige, B., Jayabalasingham, B., Zhang, H., Pypaert, M., Coppens, I.
Role of an ancestral d-bifunctional protein containing two sterol-carrier protein-2 domains in lipid uptake and trafficking in Toxoplasma. (2009 Jan, Mol Biol Cell) PubMed / full text
   more detail about this publication

anterior vesicle and cytosol and posterior vesicle during intracellular tachyzoite
  • "TgHAD-2SCP-2 Distributes to Vesicles and Cytosol in Toxoplasma...Parasites expressing HA-TgHAD-2SCP-2 labeled with anti-TgHAD-2SCP-2 antibodies for IFA (a) and immuno-EM (b), or with anti-HA antibodies (c). In fluorescence microscopy pictures, arrows and arrowheads show vesicles at the apical and basal ends of the parasite, respectively"
  • Microscopy type: Light, EM
  • Microscopy method: HA tag, polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: taken directly from publication
  • Localisation record: vesicles in apical end and vesicles in basal end and cytosol during intracellular tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12609

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_034570 peroxisomal multifunctional enzyme type 2, putative
MPVRFDGQVAIVTGAGGGLGREYALLLAARGAKVLVNDVGVALSGAASESAKTDQVVADIRARGGEAAADYNSVLDGQKI
IDHALSLFGRVDILINNAGVLRDASFMKMTHQDWNLVLDVHVRGAYACTKAAWPVMQKQNYGRIIMTASAAGLYGNFGQA
NYSTAKSALVGFAKTLAFEGAKKNILVNCIAPLAGTRMTATVLPPDLVEAMKPEFVAPLVAFLCSKDCRDSGQVLEVGAG
WVASVRWQRNIGHSFATPLSPDDIAREWRHIRDFSGEVAYPASLQDSMLMVMQQLQQGTKPTDKRAEQRGASDAKEEKKS
GASAQEGSAAIGKAEVIFKLMDAYIRNAPDARQKLQEKVDSVFGFNVTDGKTTKSWSINLKKGNAGGGVEDGLHSSPDVL
FTMAAENFVSVCLGTLNPQMAFVQGKMKIKGSMQKATKFTPSLFPPIPREVVDMTPDLAVETYLKANNFSSVPARASANE
PPKKEEKDAKHGSGKAQVPSPRAKQLKSMTLYEVMKRHLATPEGEKLVKKIKSVYRLNILPRKGADPVKVILDLKNMPPS
IREEAEQEHAACDCTITLLDEDFVKLALGKMNPQLAFVQGKIKLKGSMQAALKFTPDIFPKTSRL

Gene-Specific Links for TGME49_034570

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins