ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_034510 ()

acyl-CoA-binding protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13447

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0197 ankyrin repeat domain protein, putative
  • PBANKA_092910 conserved Plasmodium protein, unknown function
  • PY04674 similar to proteasome 26S subunit, non-ATPase, 10-related
  • PVX_091585 hypothetical protein, conserved
  • PCHAS_091520 conserved Plasmodium protein, unknown function
  • PKH_091640 conserved Plasmodium protein, unknown function
  • TGME49_034510 acyl-CoA-binding protein, putative
  • cgd1_1140 conserved hypothetical protein
  • Chro.10136 similar to proteasome 26S subunit, non-ATPase, 10-related
  • CMU_035870 acyl-CoA binding protein, putative
  • TP01_0745 hypothetical protein
  • TA06815 hypothetical protein, conserved
  • BBOV_IV010810 ankyrin repeat containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_034510 acyl-CoA-binding protein, putative
MARPVHLGTLLVSTATCLVTGYVLCKTDWPRLTRQLRRAFSRLLFQHCPVIEFTTDDVEGGPTGKLPKTFNEATSWVASH
GKACPVEDQLQLYGFYKQATVGNCADPEPSIVELARHAKWNAWRQCTGMEPEEAEEAYVGFVRDIIASRASTGTGQQKIP
PSGSPMGKPQSSLRSIEQQDDRQLSKVDRFFRHAANGDLAAIVEDLRSDAALVTARNDDDMTALHLAADRGHVDVIDFLL
EKGADVNAQDNSGETPLHVAVVAENLDVISLLLKRNADISLQSHEGETVLDVANQTDNPELVQVVTASKAT

Gene-Specific Links for TGME49_034510

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins