ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_034500 ()

phenylalanyl tRNA synthetase isoform, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10500

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFA0480w phenylalanyl-tRNA synthetase, putative
  • PBANKA_020380 phenylalanyl-tRNA synthetase, putative
  • PY00417 phenylalanyl-tRNA synthetase, putative
  • PVX_081300 phenylalanyl-tRNA synthetase beta chain, putative
  • PCHAS_020220 phenylalanyl-tRNA synthetase, putative
  • PKH_020370 phenylalanyl-tRNA synthetase, putative
  • TGME49_034500 phenylalanyl tRNA synthetase isoform, putative
  • NCLIV_042270 hypothetical protein
  • cgd3_3320 putative phenylalanyl-tRNA synthetase
  • Chro.30378 phenylalanyl-trna synthetase-like protein
  • CMU_000210 phenylalanyl-tRNA synthetase, alpha subunit family protein
  • TA10840 phenylalanine-tRNA synthetase, putative
  • BBOV_III007240 phenylalanyl-tRNA synthetase family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_034500 phenylalanyl tRNA synthetase isoform, putative
MADVASAALMDDFLQVLNKEFGLQPVVSTLALAENSEYGGKFGAHEKIVGLVKSLQANEYVLGEQVEKTVWSLTEEGQLY
AKEGSPEFRLVAWLQQRGNEEASLDVAAIKAGFGSEADVAVSNAMKMQWLRIDKATKLLHINKVPESDNVKTLLDVIQGQ
RDGNQDDAAALFKQLSELTATASPEKALQDLKKRKLVELRKVKYLKLQKGPKFSLHLMKPVADLTAELLIGDAWEKSNFK
EYNFFAAGKRIRRGAVHPLMQVMKQFKQILYCMGFEEMPTNQYVESSFWCFDSLFMPQQHPARDVQDTFFLQAPKSSDAT
KIPQAYFNSVKNIHERGGHGSIGWQYEWSEEESMGNILRTHTTASSARMLYGLAQEYKKTGVFRPRKFFSIDRVFRNETL
DATHLAEFHQVEGLVADRGLTIGHLMGVMETFYKQIGIEQLKFKPAYNPYTEPSMEIFGYHAGLKRWIEVGNSGIFRPEM
LLPMGLPEDVTVIAWGLSLERPTMIRYGISNIRQLFGHRALLGMA

Gene-Specific Links for TGME49_034500

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins