ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_033480 (SRS2) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

SRS29C (= SRS2, P35), a gene from Toxoplasma gondii

Compiled localisation
host cell plasma membrane and parasite plasma membrane during tachyzoite
during not bradyzoite and not merozoite and tachyzoite

Who localised this protein by microscopy?

Saeij, J. P., Arrizabalaga, G., Boothroyd, J. C.
A cluster of four surface antigen genes specifically expressed in bradyzoites, SAG2CDXY, plays an important role in Toxoplasma gondii persistence. (2008 Jun, Infect Immun) PubMed / full text
   more detail about this publication

host cell plasma membrane during tachyzoite

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

during tachyzoite and not bradyzoite and not merozoite

Manger, I. D., Hehl, A. B., Boothroyd, J. C.
The surface of Toxoplasma tachyzoites is dominated by a family of glycosylphosphatidylinositol-anchored antigens related to SAG1. (1998 May, Infect Immun) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite
  • "The products of two of these new genes (SRS2 and SRS3) are shown to be expressed on the surface of Toxoplasma tachyzoites by immunofluorescence."
  • Microscopy type: Light
  • Microscopy method: MBP tag
  • Strain: RH
  • Gene model mapping comments: Blast from AF012276.1, annotation doesn't match?, gene model inconsistent at 5' end?
  • Localisation record: surface during tachyzoite
  • Other genes localised in this publication: SRS51 (= SRS3)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115125

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_033480 SRS29C (= SRS2, P35)
MATRASLARQKTGAACLAVLTASPSVVAAKPWKRWVGVSVILASAFAVGVSAGPPYRYEPEKFTCRPKKGILSQWVSLLY
QVQHNITFACEEATPVPTTLISEEHGLMVCAESMTPEECEANPAPLSAFLPGATKEWVTGDSVLTGLKISVPESQYPANA
KSFRVGCRHNTKTGNTCMLTIHVEPRDPAVERQEARCSYTENSTLPKIFVTKDSNTMTLACGPHGAPMPESYTENYCSTP
DTCDEKPFTSVIPGYLSKWFFGDPKSPLGAMLRIPPEQIPSSPQIIYLGCTGPTDGEGPKYNCTVPVQLGGEDPSEGSRP
GGGSGGGKRGGGQGGGGGLAGSDSRQGSARHSLPSGMALSASALLAMTALAY

Gene-Specific Links for TGME49_033480

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins