ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_033460 (SAG1, SRS29B, P30/SAG1, BSR4, P30)

SRS29B (= SAG1, P30), a gene from Toxoplasma gondii

Compiled localisation
parasite plasma membrane during after tachyzoite invasion and bradyzoite and extracellular tachyzoite and intracellular tachyzoite and merozoite and tachyzoite
vesicle budding off zoite posterior during after tachyzoite invasion
during not bradyzoite and not enteric and not merozoite and not sporozoite and not tachyzoite and tachyzoite
not cytoplasm and not nucleus during tachyzoite

Who localised this protein by microscopy?

Daher, W., Plattner, F., Carlier, M. F., Soldati-Favre, D.
Concerted action of two formins in gliding motility and host cell invasion by Toxoplasma gondii. (2010, PLoS Pathog) PubMed / full text
   more detail about this publication

parasite plasma membrane during extracellular tachyzoite and intracellular tachyzoite

Vonlaufen, N., Naguleswaran, A., Coppens, I., Sullivan, W. J. Jr
MYST family lysine acetyltransferase facilitates ataxia telangiectasia mutated (ATM) kinase-mediated DNA damage response in Toxoplasma gondii. (2010 Apr 9, J Biol Chem) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite
  • "For reference, DNA is stained with DAPI (blue) and, for intracellular parasites, the surface antigen SAG1 is stained with anti-SAG at 1:4000 (red)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during tachyzoite
  • Other genes localised in this publication: histone acetyltransferase

Bullen, H. E., Tonkin, C. J., O'Donnell, R. A., Tham, W. H., Papenfuss, A. T., Gould, S., Cowman, A. F., Crabb, B. S., Gilson, P. R.
A novel family of Apicomplexan glideosome-associated proteins with an inner membrane-anchoring role. (2009 Sep 11, J Biol Chem) PubMed / full text
   more detail about this publication

parasite plasma membrane during extracellular tachyzoite

Pollard, A. M., Skariah, S., Mordue, D. G., Knoll, L. J.
A transmembrane domain-containing surface protein from Toxoplasma gondii augments replication in activated immune cells and establishment of a chronic infection. (2009 Sep, Infect Immun) PubMed / full text
   more detail about this publication

parasite plasma membrane during intracellular tachyzoite
  • "Immunofluorescence shows the protein on the parasite surface even in activated macrophages, co-localizing with a tachyzoite surface antigen SAG1, and oriented with its C-terminal end external."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 4100
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during intracellular tachyzoite
  • Other genes localised in this publication: hypothetical protein

Gonzalez, V., Combe, A., David, V., Malmquist, N. A., Delorme, V., Leroy, C., Blazquez, S., Menard, R., Tardieux, I.
Host cell entry by apicomplexa parasites requires actin polymerization in the host cell. (2009 Mar 19, Cell Host Microbe) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite
  • "The constriction of the entering tachyzoite can be localized by immunostaining the surface protein P30, which under nonpermeabilizing conditions sharply demarcates the extra- and intracellular portions of the zoite (Figures 2A–2D, S1A, and S1B), as well as RON4 (Figures 2E, 2F, and S1C), a tachyzoite-secreted protein that redistributes to the MJ ([Lebrun et al., 2005] and [Alexander et al., 2005])."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during tachyzoite
  • Other genes localised in this publication: hypothetical protein

Schmid, A., Sauvage, V., Escotte-Binet, S., Aubert, D., Terryn, C., Garnotel, R., Villena, I.
Molecular characterization and expression analysis of a P-glycoprotein homologue in Toxoplasma gondii. (2009 Jan, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite
  • "Immunofluorescence assay revealed a membrane-associated labeling of this protein (Fig. 6) which was punctuated and not continuously distributed along the plasma membrane compared to uniform labeling with anti-SAG1 (Fig. 6C and D)."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Uniform surface during tachyzoite
  • Other genes localised in this publication: ATP-binding cassette protein subfamily B member 1

Besteiro, S., Michelin, A., Poncet, J., Dubremetz, J. F., Lebrun, M.
Export of a Toxoplasma gondii rhoptry neck protein complex at the host cell membrane to form the moving junction during invasion. (2009 Feb, PLoS Pathog) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite
  • "The extracellular portion of the tachyzoites was labelled with anti-SAG1 (green), and, then, after permeabilization of the cells with saponin, the ring of the MJ was revealed by addition of the conjugate (red)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH HXGPRT–
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during tachyzoite
  • Other genes localised in this publication: hypothetical protein, rhoptry neck protein 2, hypothetical protein, hypothetical protein, dense granule protein 5 precursor

Gordon, J. L., Beatty, W. L., Sibley, L. D.
A novel actin-related protein is associated with daughter cell formation in Toxoplasma gondii. (2008 Sep, Eukaryot Cell) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite, during not bradyzoite

Gould, S. B., Tham, W. H., Cowman, A. F., McFadden, G. I., Waller, R. F.
Alveolins, a new family of cortical proteins that define the protist infrakingdom Alveolata. (2008 Jun, Mol Biol Evol) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite
  • "IFAs of tachyzoites using antisera to the plasma membrane marker surface antigen 1 (red) and alveolins (green) and DNA stained with 4',6-diamidino-2-phenylindole (blue)."
  • Microscopy type: Light
  • Microscopy method:
  • Strain: RH HXGPRT–
  • Gene model mapping comments: inferred from another publication
  • Localisation record: plasma membrane during tachyzoite
  • Comment: localisation method not discussed
  • Other genes localised in this publication: inner membrane complex protein 1a, putative, membrane skeletal protein IMC1

Gilk, S. D., Raviv, Y., Hu, K., Murray, J. M., Beckers, C. J., Ward, G. E.
Identification of PhIL1, a novel cytoskeletal protein of the Toxoplasma gondii pellicle, through photosensitized labeling with 5-[125I]iodonaphthalene-1-azide. (2006 Oct, Eukaryot Cell) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite

Fang, J., Marchesini, N., Moreno, S. N.
A Toxoplasma gondii phosphoinositide phospholipase C (TgPI-PLC) with high affinity for phosphatidylinositol. (2006 Mar 1, Biochem J) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite
  • "TgPI-PLC was detected in the plasma membrane of tachyzoites, but not in the host cells (Figure 6E) and co-localized with SAG1 (Figure 6F), a known plasma membrane marker [22]"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: plasma membrane during tachyzoite
  • Other genes localised in this publication: phospholipase C delta 1

Ferguson, D. J., Henriquez, F. L., Kirisits, M. J., Muench, S. P., Prigge, S. T., Rice, D. W., Roberts, C. W., McLeod, R. L.
Maternal inheritance and stage-specific variation of the apicoplast in Toxoplasma gondii during development in the intermediate and definitive host. (2005 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

during tachyzoite and not bradyzoite
  • "The presence of both tachyzoites and bradyzoites was confirmed by double labeling with antibodies to the stage-specific antigens SAG1 (tachyzoite specific) and BAG1 (bradyzoite specific) (Fig. 2a)"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: during tachyzoite and not bradyzoite
  • Comment: strain information ambiguous
  • Other genes localised in this publication: enoyl-acyl carrier reductase, bradyzoite antigen, putative, enolase 2, nucleoside-triphosphatase I

Gaskins, E., Gilk, S., DeVore, N., Mann, T., Ward, G., Beckers, C.
Identification of the membrane receptor of a class XIV myosin in Toxoplasma gondii. (2004 May 10, J Cell Biol) PubMed / full text
   more detail about this publication

parasite plasma membrane
  • "In untreated cells, the plasma membrane protein SAG1 is evenly distributed over the parasite circumference, whereas TgGAP45 distribution reveals an anterior gap (arrows) consistent with localization to the inner membrane complex."
  • Microscopy type: Light
  • Microscopy method:
  • Strain: RH HXGPRT–
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface
  • Comment: localisation method not discussed
  • Other genes localised in this publication: myosin A, putative, hypothetical protein, acid phosphatase, putative, myosin light chain TgMLC1

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during bradyzoite and merozoite and tachyzoite, during not bradyzoite and not merozoite and not sporozoite and not tachyzoite

Brossier, F., Jewett, T. J., Lovett, J. L., Sibley, L. D.
C-terminal processing of the toxoplasma protein MIC2 is essential for invasion into host cells. (2003 Feb 21, J Biol Chem) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite
  • "To determine the percentage of transfected parasites that were adherent, the proportion of c-Myc-positive parasites in the starting inoculum (c-Myc positive) was compared with the proportion of parasites that were attached to host cells following a brief invasion pulse and staining for the surface protein SAG1 (c-Myc positive and SAG positive)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH hxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during tachyzoite
  • Other genes localised in this publication: microneme protein 2, MIC2-associated protein M2AP

Herm-Gotz, A., Weiss, S., Stratmann, R., Fujita-Becker, S., Ruff, C., Meyhofer, E., Soldati, T., Manstein, D. J., Geeves, M. A., Soldati, D.
Toxoplasma gondii myosin A and its light chain: a fast, single-headed, plus-end-directed motor. (2002 May 1, EMBO J) PubMed / full text
   more detail about this publication

parasite plasma membrane during extracellular tachyzoite and intracellular tachyzoite
  • "The major surface antigen (SAG1) is detected prior to permeabilization to label the extracellular portion of the penetrating parasites preferentially, while TgMLC1 was visualized after permeabilization"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during extracellular tachyzoite and intracellular tachyzoite
  • Comment: couldn't find strain information for microscopy
  • Other genes localised in this publication: myosin light chain TgMLC1

Ferguson, D. J., Parmley, S. F., Tomavo, S.
Evidence for nuclear localisation of two stage-specific isoenzymes of enolase in Toxoplasma gondii correlates with active parasite replication. (2002 Oct, Int J Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane and not cytoplasm and not nucleus during tachyzoite, during not bradyzoite and not enteric
  • "Table 1."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RRA, NTE, M3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface and not nucleus and not cytoplasm during tachyzoite, not during bradyzoite and enteric stages
  • Other genes localised in this publication: enolase 1, enolase 2, lactate dehydrogenase, lactate dehydrogenase, bradyzoite antigen, putative

Hoff, E. F., Cook, S. H., Sherman, G. D., Harper, J. M., Ferguson, D. J., Dubremetz, J. F., Carruthers, V. B.
Toxoplasma gondii: molecular cloning and characterization of a novel 18-kDa secretory antigen, TgMIC10. (2001 Feb, Exp Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane

Reiss, M., Viebig, N., Brecht, S., Fourmaux, M. N., Soete, M., Di Cristina, M., Dubremetz, J. F., Soldati, D.
Identification and characterization of an escorter for two secretory adhesins in Toxoplasma gondii. (2001 Feb 5, J Cell Biol) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite
  • "SAG1TM-CDMIC6 accumulates precisely in the micronemes as demonstrated by immunoelectron microscopy using anti-SAG1 antibodies. SAG1 is detected by gold particles and, when GPI anchored, was found in its normal location at the parasite surface (arrowheads)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: Blast from EF585681.1, annotation matches
  • Localisation record: surface during tachyzoite
  • Other genes localised in this publication: microneme protein MIC1, microneme protein MIC4, microneme protein MIC6

Grimwood, J., Smith, J. E.
Toxoplasma gondii: redistribution of tachyzoite surface protein during host cell invasion and intracellular development. (1995, Parasitol Res) PubMed / full text
   more detail about this publication

parasite plasma membrane during after tachyzoite invasion and extracellular tachyzoite, vesicle budding off zoite posterior during after tachyzoite invasion
  • "immunoperoxidase detection of the major surface proteins SAG1 and SAG2 revealed that they were distributed uniformly on the surface of extracellular tachyzoites. During invasion of the host cell the majority of the surface label failed to pass throught the tight junction. The label appeared to remain associated with membrane accumulating at the posterior of the zoite, where it was shed in the form of vesicles. This pattern of redistribution was observed with both surface molecules (Figs. 1, 4). However, in some in- stances, shedding of the surface coat was not complete and varying amounts of label were internalised and re- mained on membrane associated with or adjacent to the parasite surface "
  • Microscopy type: EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during extracellular tachyzoite, some parasite plasma membrane during after tachyzoite invasion, vesicles budding off zoite posterior during after tachyzoite invasion
  • Other genes localised in this publication: SRS34A (= SAG2A, P22)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115123

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • NCLIV_033230 SRS domain-containing protein,SRS29B, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_033460 SRS29B (= SAG1, P30)
MFPKAVRRAVTAGVFAAPTLMSFLRCGAMASDPPLVANQVVTCPDKKSTAAVILTPTENHFTLKCPKTALTEPPTLAYSP
NRQICPAGTTSSCTSKAVTLSSLIPEAEDSWWTGDSASLDTAGIKLTVPIEKFPVTTQTFVVGCIKGDDAQSCMVTVTVQ
ARASSVVNNVARCSYGANSTLGPVKLSAEGPTTMTLVCGKDGVKVPQDNNQYCSGTTLTGCNEKSFKDILPKLSENPWQG
NASSDNGATLTINKEAFPAESKSVIIGCTGGSPEKHHCTVQLEFAGAAGSAKSSAGTASHVSIFAMVTGLIGSIAACVA

Gene-Specific Links for TGME49_033460

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins