ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_033450 (SRS1)

SRS29A (= SRS1), a gene from Toxoplasma gondii

Compiled localisation
host cell plasma membrane during tachyzoite
parasite plasma membrane during extracellular tachyzoite

Who localised this protein by microscopy?

Saeij, J. P., Arrizabalaga, G., Boothroyd, J. C.
A cluster of four surface antigen genes specifically expressed in bradyzoites, SAG2CDXY, plays an important role in Toxoplasma gondii persistence. (2008 Jun, Infect Immun) PubMed / full text
   more detail about this publication

host cell plasma membrane during tachyzoite

Hehl, A., Krieger, T., Boothroyd, J. C.
Identification and characterization of SRS1, a Toxoplasma gondii surface antigen upstream of and related to SAG1. (1997 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasite plasma membrane during extracellular tachyzoite
  • "3.5. SRS1 is a surface antigen"
  • Microscopy type: Light
  • Microscopy method: antibody against amino acids 59-399
  • Strain: RH
  • Gene model mapping comments: Blast from U77677
  • Localisation record: surface during free tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>TGME49_033450 SRS29A (= SRS1)
MVRTSLIEHRTGRRVVAAPDRGSLQVCIVFNIALSATIAAMMTSPLSVASMTSPLLTWDGNKVTCHPEKGDVDDWIGLVP
QQNEVTFACEGKGVTPVPKNLVNSKSREVCAQGMSANACEKDPRPLSEILKGAQNDWLNGEDLSRGITFRVPKNNFPGLP
RIFRIGCRTRSNICMISLHIYAKSAYTSGQVTECAYESNVSLPPVRITPATNHATIVCGPYGGISPLDYKKEFCTGEPHT
SCGRQKYADVLPRYTDAWWNGDPSTAEGATLTVPNGHFPKETQTLKFMCLERLDTQPRRCVVTVEIAAGVSGSKPSGGES
IPPQAPGTEGSRKEAPNTNNSGGTPTGGGSDDDTTAPGTGSSGTDSRGDLGDGRDQDAKGGMSRGNSESGSNGGATQPSR
LLGLPSAVIGTLAAAMFGAV

Gene-Specific Links for TGME49_033450

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins