ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_033140 ()

deoxyuridine 5'-triphosphate nucleotidohydrolase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10449

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0282 deoxyuridine 5'-triphosphate nucleotidohydrolase
  • PBANKA_092130 deoxyuridine 5'-triphosphate nucleotidohydrolase, putative
  • PY05536 putative deoxyuridine 5'-triphosphate nucleotidohydrolase
  • PVX_091970 deoxyuridine 5'-triphosphate nucleotidohydrolase, putative
  • PCHAS_092310 deoxyuridine 5'-triphosphate nucleotidohydrolase, putative
  • PKH_092480 deoxyuridine 5'-triphosphate nucleotidohydrolase, putative
  • TGME49_033140 deoxyuridine 5'-triphosphate nucleotidohydrolase, putative
  • NCLIV_032950 deoxyuridine 5'-triphosphate nucleotidohydrolase, putative
  • cgd7_5170 deoxyuridinetriphosphatase, possible bacterial origin
  • Chro.70577 deoxyuridine 5'-triphosphate nucleotidohydrolase
  • CMU_019310 deoxyuridine 5'-triphosphate nucleotidohydrolase family protein
  • TP01_0381 deoxyuridine 5'-triphosphate nucleotidohydrolase, putative
  • TA20975 deoxyuridine 5'-triphosphate nucleotidohydrolase, putative
  • BBOV_IV005770 deoxyuridine 5'-triphosphate nucleotidohydrolase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_033140 deoxyuridine 5'-triphosphate nucleotidohydrolase, putative
MLLRVQALTPEVRAMYAAHGHYHEGDSGVDLFVVQDQEIQPGETAFVKLGIKAAAFTPAEGGEQEKNVSWLIMPRSSISK
TPLRLANSVGLIDAGYRGEIMAAVDNIKTVPHTLKKGDRIVQAVAFSGEGITLELVDELNKTARGEGGFGSTTCPAGEPE
MKKAKNDVAN

Gene-Specific Links for TGME49_033140

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins