ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_033110 (IMPDH)

inosine-5'-monophosphate dehydrogenase, putative, a gene from Toxoplasma gondii

Compiled localisation
cytoplasm during tachyzoite

Who localised this protein by microscopy?

Sullivan, W. J. Jr, Dixon, S. E., Li, C., Striepen, B., Queener, S. F.
IMP dehydrogenase from the protozoan parasite Toxoplasma gondii. (2005 Jun, Antimicrob Agents Chemother) PubMed / full text
   more detail about this publication

cytoplasm during tachyzoite
  • "When TgIMPDH is expressed as a recombinant protein fused to a FLAG tag, the fusion protein localizes to the parasite cytoplasm."
  • Microscopy type: Light
  • Microscopy method: FLAG tag
  • Strain: RH
  • Gene model mapping comments: blast from AY661469.1, annotation matches
  • Localisation record: cytoplasm during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10357

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PFI1020c inosine-5'-monophosphate dehydrogenase
  • PBANKA_082170 inosine-5'-monophosphate dehydrogenase, putative
  • PY03601 inosine-5'-monophosphate dehydrogenase
  • PVX_099455 inosine-5'-monophosphate dehydrogenase, putative
  • PCHAS_082200 inosine-5'-monophosphate dehydrogenase, putative
  • PKH_071800 inosine-5'-monophosphate dehydrogenase, putative
  • NCLIV_032920 hypothetical protein
  • cgd6_20 inosine-5-monophosphate dehydrogenase
  • Chro.60012 inosine-5-monophosphate dehydrogenase
  • TA03405 inosine-5'-monophosphate dehydrogenase, putative
  • BBOV_IV006900 inosine-5'-monophosphate dehydrogenase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_033110 inosine-5'-monophosphate dehydrogenase, putative
MADGWDAEKIFNTTVFGFTYDDLILMPGHIDFGVNDVDLSTRITRNLHVRTPIVSSPMDTVTEHRMAIGCALMGGMGVIH
NNMETARQVAEVQKVKRYENGFILDPFVLRPSDSVADVYRIKEKYGYSSVPITDTGMLGGKLLGIVTSRDIDFLTDVHTP
LSEVMTSDLVVGHEPVQLAEANELLRESKKGKLPIVNDNFELVALISRNDLKKNREFPLASKDSNKQLLVGAAVSTKPHD
IERAKALQEAGADVLVVDSSQGDSIYQVDLVKRLKAAFPELQIIGGNVVTARQAKSLIDAGVDGLRIGMGSGSICTTQVV
CAVGRAQATAVYHVCKYAREHGDLPCIADGGIQNSGHVMKALALGANAVMMGSMLAGTEEAPGEYYFHNGVRVKTYRGMG
SLDAMRAGTWRNASPPARGLRSPEASPSTAASSGGASRASALSEASPSAKSEASRTSTSTGSAARYFAENQTIRVAQGVS
GCVVDKGTVMQLIPYVIQGVKHGMQDIGARTLRDLHAQLVGGELRFDVRSGAAQREGDVHDLHSFERKLYA

Gene-Specific Links for TGME49_033110

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins