ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_033030 (GAP70) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

myosin-A docking protein, putative, a gene from Toxoplasma gondii

Compiled localisation
apical cap and inner membrane complex during tachyzoite

Who localised this protein by microscopy?

Frenal, K., Polonais, V., Marq, J. B., Stratmann, R., Limenitakis, J., Soldati-Favre, D.
Functional dissection of the apicomplexan glideosome molecular architecture. (2010 Oct 21, Cell Host Microbe) PubMed / full text
   more detail about this publication

apical cap and inner membrane complex during tachyzoite
  • "By IFA, TyGAP70 was concentrated at the apical cap but also distributed throughout the entire pellicle,"
  • Microscopy type: fixed light
  • Microscopy method: Ty tag
  • Strain: RH
  • Gene model mapping comments: blast from HM117968, gene model inconsistent?
  • Localisation record: concentrated apical cap and pellicle during tachyzoite
  • Other genes localised in this publication: hypothetical protein, conserved, hypothetical protein, myosin light chain TgMLC1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_26935

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_033030 myosin-A docking protein, putative
MGGACTKNRTKQPGRKKAQELAERQRREQEAIAEDERKKMEEAAEQRRQLEKEDSRLREEEEASLASPQRAEAEEGKQAE
ERAEEEERERAEEEDRRRTEEEDRRRTEEEDRRRTEEEERRRAEEEERRRAEEEERRRAEEEERRRAQEEERRRAQEEDR
RRTEEEERRRAEEEERRRTEEEERRRAQEEDRRRAQEAEERRRKEEELARQRREEDARAERKIKEEEERRREEVEAERRR
LEEEEEAAHRRKLLEEESDEYTSESPSDQEQYDLDTESGTSSPATVSSRVPRSVTGNTCQRRSRKVHGANMKVVHKAARI
VSHHCGCELEPLHDDLTCPVCEFTDMGDVPLLR

Gene-Specific Links for TGME49_033030

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins