ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_032940 (Hsp20)

small heat shock protein 20, a gene from Toxoplasma gondii

Compiled localisation
apical during bradyzoite and intracellular tachyzoite
parasite plasma membrane during bradyzoite

Who localised this protein by microscopy?

de Miguel, N., Echeverria, P. C., Angel, S. O.
Differential subcellular localization of members of the Toxoplasma gondii small heat shock protein family. (2005 Dec, Eukaryot Cell) PubMed / full text
   more detail about this publication

apical during bradyzoite and intracellular tachyzoite, parasite plasma membrane during bradyzoite
  • "In tachyzoite and bradyzoite stages, Hsp20 antiserum gave a crescent-shaped pattern at the apical end of the cell, labeling mostly a small area at the conoid of the parasite (Fig. 4B and E). Moreover, in some bradyzoites a membrane-associated labeling was also observed (Fig. 4H)."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: PK
  • Gene model mapping comments: blast from AY644771, annotation matches
  • Localisation record: apical during intracellular tachyzoite
  • Other genes localised in this publication: heat shock protein 28, Hsp20/alpha crystallin domain-containing protein, small heat shock protein 21
  • "Note the targeting of Hsp20 at the apical region in the merged labeled image (merged) in tachyzoites (C) and bradyzoites (F) and the membrane-associated labeling in bradyzoite stages (I)."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: ME49
  • Gene model mapping comments: inferred from another publication
  • Localisation record: membrane and apical during bradyzoite
  • Other genes localised in this publication: heat shock protein 28, Hsp20/alpha crystallin domain-containing protein, small heat shock protein 21

Orthology

OrthoMCL

Part of OrthoMCL group OG4_25320

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_032940 small heat shock protein 20
MCCCATRMSCCGGTVAEHEVVLDNTGDMDEMLPDQLIPSVPRSGNLLLAANKIAEIQAPAEIRSKITWRPGVDIFFDKKE
SSIDLVMDLPGFTKDDVSVEVGEGQLFISGPRSKNELREKYGANLVLSIHERPTGFFFRSFQLPPNAVEDSVRAVMTNGL
LEVKISCIQTHEKKKVEVLLPGAAQGEKASKK

Gene-Specific Links for TGME49_032940

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins