ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_032830 ()

vacuolar proton-translocating ATPase subunit, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10178

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF08_0113 vacuolar proton translocating ATPase subunit A, putative
  • PBANKA_122380 vacuolar proton-translocating ATPase subunit A, putative
  • PY05420 vacuolar proton translocating ATPase 116 kDa subunit a isoform 1
  • PVX_088205 vacuolar proton translocating ATPase subunit A, putative
  • PCHAS_122440 vacuolar proton-translocating ATPase subunit A, putative
  • PKH_011150 vacuolar proton translocating ATPase subunit A, putative
  • TGME49_032830 vacuolar proton-translocating ATPase subunit, putative
  • TGME49_090720 vacuolar proton-translocating ATPase subunit, putative
  • NCLIV_032770 hypothetical protein
  • NCLIV_042690 vacuolar proton-translocating ATPase subunit, putative
  • cgd4_1470 vacuolar proton translocating ATpase with 7 transmembrane regions near C-terminus
  • Chro.40167 vacuolar proton translocating ATPase 116 kDa subunit a isoform 1
  • CMU_028580 vacuolar proton translocating ATPase subunit A, putative
  • TA10280 vacuolar H+ ATPase, 116 kDa subunit, putative
  • BBOV_III008300 V-type ATPase 116kDa subunit family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_032830 vacuolar proton-translocating ATPase subunit, putative
MTTLRSEPMLRGTLVLPSALPLAHGCLEALGRQGSVHFLDMNAHSLTRQFNTYIQRIDEMERIIRFLEEEVNRLQDAGAK
IIVGPEGAQNFLDNDKSYQLDKVEEALNRLHAQFVRFKSNNADLIQQKNAALEEKCVMTTAVQQLQGSAMKDGFSAGAQN
SPADGTAAGNSEEEVAKALLRQDDNKDMTPNADDPEAGLTKTEGGSSGSSVSTVAGMIATSAIGRFQRMLFRTTRGNAFC
FFQSTAEKLVDSNTGNEVEKGVFVIYYQGAAHSLLREKIVKVCAAFDAKPYEWPHSAEEAATRLAGLQSLLDDKERALAA
YEKYFLSEISLLLEVTRPGGSSLLEEWKMFCQKEKAVYATLNQFQGKDMTLRCDCWIPRDKEEEIRSILKDVSTDPNGEE
QASAFLLIEKGQPTAMPPTYFKTTEFTEPSQVMVDTYGVPRYQEANPAVLTTITFPFLFGVMYGDIGHGLCVMLMGLWLL
FRANALKQDRTAALHGAVKYRYMVFLMGFFAFFGGFMYNDWFALGLDIFGSRWTLKGAEAGSSSITMRKKDGEFPYPFGF
DPAWKGATNELLFTNSFKMKFSVIVGFAQMFAGVLLKGSNAIFFREPLDFVFEFIPQVMFICSLVGYMDFLILYKWATPA
DQNKPNLINTIINMCMLAEVKSEDEMFSNQQTVERILLVFMVISIPLMLIPKPLILCSRLKKNHPPGAHKERLSSGKTNS
STIELEHAPSGGANGAGAAAAVGDGNENSAIEAGLRKQGTTEEREGNVLSVIKEEIGEEHEGPGDIFIHQMIETIEFILG
TISNTASYLRLWALSLAHQQLALVFYTQTVVRAIELTDNTTFVALALFVIFAAYACITFAVILCMDFLEVSLHALRLQWV
EFQNKFFKGDGYKFAPLYFIKLLQGEDDA

Gene-Specific Links for TGME49_032830

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins