ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_032660 (Hip)

58 kDa phosphoprotein, putative, a gene from Toxoplasma gondii

Compiled localisation
cytoplasm and not nucleus during bradyzoite and tachyzoite

Who localised this protein by microscopy?

Echeverria, P. C., Figueras, M. J., Vogler, M., Kriehuber, T., de Miguel, N., Deng, B., Dalmasso, M. C., Matthews, D. E., Matrajt, M., Haslbeck, M., Buchner, J., Angel, S. O.
The Hsp90 co-chaperone p23 of Toxoplasma gondii: Identification, functional analysis and dynamic interactome determination. (2010 Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytoplasm and not nucleus during bradyzoite and tachyzoite
  • "Hip showed a cytoplasmic localization in tachyzoite and bradyzoite stages (Fig. 6), without any co-localization with propidium iodide stained nuclei"
  • Microscopy type: fixed light
  • Microscopy method: antibody
  • Strain: PK
  • Gene model mapping comments: taken directly from publication
  • Localisation record: cytoplasm and not nuclei during tachyzoite and bradyzoite
  • Other genes localised in this publication: heat shock protein 90, P23 co-chaperone, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12561

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_032660 58 kDa phosphoprotein, putative
MAALSPQKVAELKAFIGMCERDPSILHRPELSFFKEYLQSLKAAIPAERQAGAGSPDRPTTSPVPEASSDDSSLESEVEE
FDEESLKDSEVIPPETSPLPPLAPEGEKELTDDELDKLGKLKEEASAACEAGNSERALEKFTEALLIGNPTALLYTRRAD
VLLKLKRPVACIRDCDEALKLNPDSARAYKIRGKANRLLGKWREAHSDLDMGQKIDYDEGLWDMQKLVDEKFKKIEEHER
KIVRKCEEAEKKRREKEARKRRAAAQRAYEEQKQRDAAGSGGFPGGFPEGFPGFGGGAGFPGGAGGFGYSGGMPGTFPSS
SCGGSGMTGTPGGCCGGMGGGCGGGMPSNSVPGGAGNLFGALNDPELKKLFENPKMMAAFQDIMSNPSSISKYASDPEVM
AAMGSLTSKFGGGVPGAGFPTGSPM

Gene-Specific Links for TGME49_032660

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins