ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_032400 ()

PAN domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation
parasitophorous vacuole during tachyzoite

Who localised this protein by microscopy?

Chen, Z., Harb, O. S., Roos, D. S.
In silico identification of specialized secretory-organelle proteins in apicomplexan parasites and in vivo validation in Toxoplasma gondii. (2008, PLoS One) PubMed / full text
   more detail about this publication

parasitophorous vacuole during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115094

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_032400 PAN domain-containing protein
MVSKRVQTALAVLLPGLLLAKSGVQRVDAQVDAEDLLRLNIPNDCPVQQEQTNFQMAEFTGVPFNATCQRYCAEHPECAA
FTYHADSRRCVLHSRTGNLAEKATARFSRKRCPTCLLDNFNVADTEDDYLVIAMTVQGCASECRTRGCNFYVYDKESKKC
HFKRHRDGIQSAIRPQQGLQVGFHNCRNTDSWCFAPNHTLQGETLKTTTASGPLHCSEICLNHAGCAAFSFDVGSKACHL
KPASAFDHVAPQNGSFFGPPGCGLPQACETQGKRRAGDFLMSFSPNSIKTNKGCQRRCQENHRCFHYSFGPEGCFLHGLG
SVAEDVEGYISGDTNCGI

Gene-Specific Links for TGME49_032400

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins