ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_032350 (lactate dehydrogenase-1, LDH1)

lactate dehydrogenase, a gene from Toxoplasma gondii

Compiled localisation
cytosol during intracellular tachyzoite
inner membrane complex during extracellular tachyzoite
cytoplasm during enteric and merozoite and tachyzoite
not nucleus during enteric and tachyzoite
during not bradyzoite and tachyzoite

Who localised this protein by microscopy?

Pomel, S., Luk, F. C., Beckers, C. J.
Host cell egress and invasion induce marked relocations of glycolytic enzymes in Toxoplasma gondii tachyzoites. (2008 Oct, PLoS Pathog) PubMed / full text
   more detail about this publication

cytosol during intracellular tachyzoite, inner membrane complex during extracellular tachyzoite

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

during tachyzoite and not bradyzoite, cytoplasm during merozoite

Ferguson, D. J., Parmley, S. F., Tomavo, S.
Evidence for nuclear localisation of two stage-specific isoenzymes of enolase in Toxoplasma gondii correlates with active parasite replication. (2002 Oct, Int J Parasitol) PubMed / full text
   more detail about this publication

cytoplasm and not nucleus during enteric and tachyzoite, during not bradyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10365

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_032350 lactate dehydrogenase
MAPALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGAD
CVIVTAGLTKVPGKPDSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMCEASGVPTNMICGMACML
DSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQ
GSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMAL
NKAVAALQA

Gene-Specific Links for TGME49_032350

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins