ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_032250 (Catalase)

peroxisomal catalase, a gene from Toxoplasma gondii

Compiled localisation
cytoplasm and not peroxisome during bradyzoite and tachyzoite
cytosol during extracellular tachyzoite
not apicoplast and not dense granule and not microneme and not nucleus and not rhoptry and peroxisome during intracellular tachyzoite

Who localised this protein by microscopy?

Ding, M., Kwok, L. Y., Schluter, D., Clayton, C., Soldati, D.
The antioxidant systems in Toxoplasma gondii and the role of cytosolic catalase in defence against oxidative injury. (2004 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

cytosol during extracellular tachyzoite
  • "IFA performed on RHhxpgrt – and RHcat – strains using several anti-catalase antibodies demonstrated consistently that the diffuse cytosolic staining was the only specific labelling that corresponded to the catalase. In contrast, the various punctuated staining patterns observed previously (Ding et al., 2000; Kaasch and Joiner, 2000) persisted in the RHcat– mutant and therefore were unspecific (Fig. 6B)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Rhhxpgrt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytosol during extracellular tachyzoite
  • Other genes localised in this publication: iron-containing superoxide dismutase, superoxide dismutase, putative, peroxiredoxin 3, glutathione/thioredoxin peroxidase, putative, myosin light chain TgMLC1

Ding, M., Clayton, C., Soldati, D.
Toxoplasma gondii catalase: are there peroxisomes in toxoplasma? (2000 Jul, J Cell Sci) PubMed / full text
   more detail about this publication

cytoplasm and not peroxisome during bradyzoite and tachyzoite
  • "Immunofluorescence assays using an antibody raised against a catalase peptide identified a distinct structure towards the apical end, but other catalase-specific antibodies failed to confirm this localisation. Cell fractionations indicated that the majority of the enzyme was in the cytosol. The fusion of the C-terminal twelve amino acids, including AKM, or the canonical peroxisomal targeting signal, -SKL, to GFP resulted in predominantly cytosolic localization in T. gondii."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein, GFP
  • Strain: Rhhxgprt-, Prugniaud
  • Gene model mapping comments: Blast from AF161267.1, annotation matches
  • Localisation record: cytoplasm and not peroxisome during tachyzoite and bradyzoite
  • Comment: multiple antibodies gave different staining patterns – not a simple localisation
  • Other genes localised in this publication: dense granule protein 3, microneme protein MIC3, Rhoptry kinase family protein ROP2A (incomplete catalytic triad)

Kaasch, A. J., Joiner, K. A.
Targeting and subcellular localization of Toxoplasma gondii catalase. Identification of peroxisomes in an apicomplexan parasite. (2000 Jan 14, J Biol Chem) PubMed / full text
   more detail about this publication

peroxisome and not apicoplast and not dense granule and not microneme and not nucleus and not rhoptry during intracellular tachyzoite
  • "Catalase (green channel) does not colocalize with various parasite organelles by IFA. Micronemes (a), rhoptries (c), and dense granules (e) (all in the red channel) are labeled with monoclonal mouse antibodies to organellar proteins."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: peroxisome and not microneme and not rhoptry and not dense granule and not apicoplast and not nucleus during intracellular tachyzoite
  • Other genes localised in this publication: Rhoptry kinase family protein ROP2A (incomplete catalytic triad), dense granule protein 3, microneme protein 2

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10606

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_032250 peroxisomal catalase
MTQVPPVTFQQYGPVITTSAGNPVDDNQNSVTAGPYGPAILSNFHLIDKLAHFDRERIPERVVHAKGGGAFGYFEVTHDI
TRFCKAKLFEKIGKRTPVFARFSTVAGESGSADTRRDPRGFALKFYTEEGNWDMVGNNTPIFFVRDAIKFPDFIHTQKRH
PQTHLHDPNMVWDFFSLVPESVHQVTFLYTDRGTPDGFRHMNGYGSHTFKFINKDNEAFYVKWHFKTNQGIKNLNRQRAK
ELESEDPDYAVRDLFNAIAKREFPSWTFCIQVMPLKDAETYKWNVFDVTKVWPHGDYPLIPVGRLVLDRNPENYFQDVEQ
AAFAPAHMVPGIEPSEDRMLQGRMFSYIDTHRHRLGANYHQIPVNRPWNARGGDYSVRDGPMCVDGNKGSQLNYEPNSVD
GFPKEDRNAAVSGTTTVSGTVACHPQEHPNSDFEQPGNFYRTVLSEPEREALIGNIAEHLRQARRDIQERQVKIFYKCDP
EYGERVARAIGLPTAACYPAKM

Gene-Specific Links for TGME49_032250

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins