ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_031910 ()

ATP synthase gama chain, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10526

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF13_0061 ATP synthase gamma chain, mitochondrial precursor, putative
  • PBANKA_140980 ATP synthase gamma chain, mitochondrial precursor, putative
  • PY02803 ATP synthase F1, gamma subunit
  • PVX_122395 ATP synthase gamma chain, mitochondrial precursor, putative
  • PCHAS_141170 ATP synthase gamma chain, mitochondrial precursor, putative
  • PKH_141020 ATP synthase gamma chain, mitochondrial precursor, putative
  • TGME49_031910 ATP synthase gama chain, putative
  • NCLIV_031920 ATP synthase gama chain, putative
  • CMU_017340 ATP synthase F1, gamma subunit, putative
  • TP01_0201 ATP synthase F1, gamma chain, putative
  • TA19395 ATP synthase gamma chain, mitochondrial precursor, putative
  • BBOV_IV005350 ATP synthase F1 gamma subunit , putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_031910 ATP synthase gama chain, putative
MAGLASLSSVGALRGMRLVPAAHLLPLHSAFGQQTRNFGAGDLKIVAARMKSVKSIQKITKAMKMVAASKLRMDQRRLEN
GLPFATPVQKLVQRIPVDPKEKGTLAVLALSSDKGLCGGVNSFVAKQARIVIKENEMAGNAVQVYGVGDKIRSALQRTFG
DRFKRIMTEVTRFPWNFGQACIIADRLMQDNPARLMVIYNHFKSAVAYDTLTLNVLTPTQAAQSAKEQLNTFEFEPEKTD
VWKDLQDFYYACTVFGCMLDNIASEQSARMSAMDNASTNAGEMISSLTLRYNRARQAKITTELVEIISGANALE

Gene-Specific Links for TGME49_031910

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins