ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_031850 (PP2C)

serine-threonine phosophatase 2C, a gene from Toxoplasma gondii

Compiled localisation
cytoplasm and not rhoptry and nucleus during intracellular tachyzoite

Who localised this protein by microscopy?

Jan, G., Delorme, V., Saksouk, N., Abrivard, M., Gonzalez, V., Cayla, X., Hakimi, M. A., Tardieux, I.
A Toxoplasma type 2C serine-threonine phosphatase is involved in parasite growth in the mammalian host cell. (2009 Oct, Microbes Infect) PubMed / full text
   more detail about this publication

cytoplasm and nucleus and not rhoptry during intracellular tachyzoite
  • "Both TgPP2C and TgPP2C-HA-FLAG enzymes display a cytoplasmic and nuclear localization in intracellular dividing tachyzoites"
  • Microscopy type: Light
  • Microscopy method: HA tag, polyclonal antibody directly to protein
  • Strain: RH HXGPRT
  • Gene model mapping comments: Blast from CAC86553.2, annotation matches, taken directly from publication
  • Localisation record: cytoplasm and nucleus and not rhoptry during intracellular tachyzoite
  • Comment: This is not the same gene as TgPP2Chn
  • Other genes localised in this publication: Rhoptry kinase family protein ROP2A (incomplete catalytic triad), histone H4, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_36213

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • NCLIV_031860 serine-threonine phosophatase 2C, putative
  • cgd5_840 PP2C like phosphatase
  • Chro.50303 serine-threonine phosophatase 2C
  • CMU_041050 protein phosphatase 2C, putative
  • TA08300 serine/threonine protein phosphatase 2C, putative
  • BBOV_II001720 serine threonine phosphatase 2C containing protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_031850 serine-threonine phosophatase 2C
MKSSAEIRRTMDVPPTIHVPLPPTSYPAFDAAIFTDIGGRKHQEDRFTLCPQLVPGRDDCAFFGVFDGTVGDFASENVKD
LVVPQLISSPAWQEVTEMLRSDVPATEVDEKLPQLLDQAVDDMYKNADNELVKMCEQLNKDYASSTSVTAVLAKGFVAVG
HLGDSRIAMGVETPNGLNCEFLTVDHKPDMPHEKLRIMRNGGSVEYLHNHNNKPFIRGGDFSFRKSRGEQPMQLQYSRAF
GGKDLKMYGLSNQPDVRVVRVTPQHRVMILATDGLWDVMSAAQAVEIAMQARQEGRNPAQALVEMTLAEQQSRNQSADNI
TAMTVFFKKTD

Gene-Specific Links for TGME49_031850

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins