ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_031640 (IMC1, ALV1, IMC, NET1)

membrane skeletal protein IMC1, a gene from Toxoplasma gondii

Compiled localisation
inner membrane complex during 20 hours after tachyzoite infection and daughter tachyzoites before acquisition of plasma membrane and early tachyzoite cell division and extracellular tachyzoite and intracellular tachyzoite and late tachyzoite cell division and mother tachyzoite mitotic division and tachyzoite mitosis and tachyzoite schizont and tachyzoite
beneath alveoli during tachyzoite
not residual body during intracellular tachyzoite
during not microgametocytogeny
peripheral
daughter cytoskeleton and mother cytoskeleton during tachyzoite budding

Who localised this protein by microscopy?

Anderson-White, B. R., Ivey, F. D., Cheng, K., Szatanek, T., Lorestani, A., Beckers, C. J., Ferguson, D. J., Sahoo, N., Gubbels, M. J.
A family of intermediate filament-like proteins is sequentially assembled into the cytoskeleton of Toxoplasma gondii. (2011 Jan, Cell Microbiol) PubMed / full text
   more detail about this publication

daughter cytoskeleton and mother cytoskeleton during tachyzoite budding

Agop-Nersesian, C., Egarter, S., Langsley, G., Foth, B. J., Ferguson, D. J., Meissner, M.
Biogenesis of the inner membrane complex is dependent on vesicular transport by the alveolate specific GTPase Rab11B. (2010, PLoS Pathog) PubMed / full text
   more detail about this publication

inner membrane complex
  • "Parasites were double-labelled with anti-myc (red) and anti-IMC1 (green) to visualise Rab11B and IMC1. Rab11B cycles from a location close to the nucleus (interphase parasites in upper panel) to the growing IMC of the daughter parasites (dividing parasites in middle and lower panel) in a cell cycle dependent manner."
  • Microscopy type: light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: inner membrane complex
  • Other genes localised in this publication: Rab 11b, putative, gorasp2-prov protein

Heaslip, A. T., Dzierszinski, F., Stein, B., Hu, K.
TgMORN1 is a key organizer for the basal complex of Toxoplasma gondii. (2010 Feb, PLoS Pathog) PubMed / full text
   more detail about this publication

inner membrane complex during early tachyzoite cell division and late tachyzoite cell division
  • "Green: anti-IMC1 antibody labeling highlighting the protein network underneath the inner membrane complex (IMC)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: inner membrane complex during beginning of cell division and late stage of cell division
  • Comment: strain information not found
  • Other genes localised in this publication: phosphatidylinositol-4-phosphate 5-kinase, putative

Heaslip, A. T., Leung, J. M., Carey, K. L., Catti, F., Warshaw, D. M., Westwood, N. J., Ballif, B. A., Ward, G. E.
A small-molecule inhibitor of T. gondii motility induces the posttranslational modification of myosin light chain-1 and inhibits myosin motor activity. (2010 Jan, PLoS Pathog) PubMed / full text
   more detail about this publication

peripheral
  • "(C) Dual label immunofluorescence of intracellular parasites expressing TgMLC11–79YFP, using antibodies against TgIMC1 and GFP. TgMLC11–79YFP largely colocalizes with TgIMC1, indicating that the first 79 amino acids of TgMLC1 are sufficient for peripheral localization."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: peripheral
  • Comment: strain information not found
  • Other genes localised in this publication: myosin light chain TgMLC1

van Dooren, G. G., Reiff, S. B., Tomova, C., Meissner, M., Humbel, B. M., Striepen, B.
A novel dynamin-related protein has been recruited for apicoplast fission in Toxoplasma gondii. (2009 Feb 24, Curr Biol) PubMed / full text
   more detail about this publication

inner membrane complex
  • "Immunofluorescence assay of DD-DrpAK42A parasites grown in the absence (B) or presence (C) of Shield-1, coexpressing apicoplast RFP (red) and labeled with an anti-IMC antibody (green)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: inner membrane complex
  • Comment: strain information not found
  • Other genes localised in this publication: dynamin-like protein, putative, acyl carrier protein, phosphatidylinositol-4-phosphate 5-kinase, putative

Pomel, S., Luk, F. C., Beckers, C. J.
Host cell egress and invasion induce marked relocations of glycolytic enzymes in Toxoplasma gondii tachyzoites. (2008 Oct, PLoS Pathog) PubMed / full text
   more detail about this publication

inner membrane complex during extracellular tachyzoite
  • "When we used our affinity-purified antibodies to Toxoplasma aldolase-1 to localize this enzyme in intracellular parasites, we found it to be distributed throughout the parasites' cytoplasm (Figure 3A and Figure 4), irrespective of the fixation conditions used. In extracellular parasites, on the other hand, the protein localized to the parasite periphery (Figure 3A, C) where it overlapped with IMC1, a membrane skeleton protein of the Toxoplasma IMC"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: IMC during extracellular tachyzoite
  • Other genes localised in this publication: hexokinase, fructose-1,6-bisphosphate aldolase, glyceraldehyde-3-phosphate dehydrogenase, facilitative glucose transporter, putative, pyruvate kinase, putative, lactate dehydrogenase

Gordon, J. L., Beatty, W. L., Sibley, L. D.
A novel actin-related protein is associated with daughter cell formation in Toxoplasma gondii. (2008 Sep, Eukaryot Cell) PubMed / full text
   more detail about this publication

inner membrane complex
  • "Parasites were stained with antibodies to proteins found in different subcellular compartments in Toxoplasma, including HMGB1 in the nucleus, p30-GFP-HDEL in the ER, SAG1 in the plasma membrane, H-ATPase in acidocalcisomes, MIC2 in micronemes, GRA1 in dense granules, ROP1-GFP in rhoptries, and TUB in microtubules (see Table S2 in the supplemental material)."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: inner membrane complex
  • Other genes localised in this publication: actin, putative, actin, SRS29B (= SAG1, P30), bradyzoite antigen, putative, microneme protein 2, dense granule protein 1 / major antigenp24, rhoptry protein, putative

Gould, S. B., Tham, W. H., Cowman, A. F., McFadden, G. I., Waller, R. F.
Alveolins, a new family of cortical proteins that define the protist infrakingdom Alveolata. (2008 Jun, Mol Biol Evol) PubMed / full text
   more detail about this publication

beneath alveoli during tachyzoite
  • "FIG. 5.— Immunolocalization of alveolins beneath the alveoli in the apicomplexan Toxoplasma gondii."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody to homologue
  • Strain: RH HXGPRT–
  • Gene model mapping comments: taken directly from 18359944
  • Localisation record: beneath alveoli during tachyzoite
  • Other genes localised in this publication: inner membrane complex protein 1a, putative, SRS29B (= SAG1, P30)

Gubbels, M. J., Lehmann, M., Muthalagi, M., Jerome, M. E., Brooks, C. F., Szatanek, T., Flynn, J., Parrot, B., Radke, J., Striepen, B., White, M. W.
Forward genetic analysis of the apicomplexan cell division cycle in Toxoplasma gondii. (2008 Feb 8, PLoS Pathog) PubMed / full text
   more detail about this publication

inner membrane complex during intracellular tachyzoite
  • "co-stained with antibodies αIMC1 (red, inner membrane complex and daughter buds) and αPCNA1 (green, replication foci) and also with DAPI (blue, DNA)."
  • Microscopy type: fixed light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: inner membrane complex during intracellular tachyzoite
  • Other genes localised in this publication: proliferating cell nuclear antigen 1, inner membrane complex protein IMC3

Ferguson, D. J., Sahoo, N., Pinches, R. A., Bumstead, J. M., Tomley, F. M., Gubbels, M. J.
MORN1 has a conserved role in asexual and sexual development across the apicomplexa. (2008 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

during not microgametocytogeny

Nishi, M., Hu, K., Murray, J. M., Roos, D. S.
Organellar dynamics during the cell cycle of Toxoplasma gondii. (2008 May 1, J Cell Sci) PubMed / full text
   more detail about this publication

inner membrane complex during intracellular tachyzoite

Shea, M., Jakle, U., Liu, Q., Berry, C., Joiner, K. A., Soldati-Favre, D.
A family of aspartic proteases and a novel, dynamic and cell-cycle-dependent protease localization in the secretory pathway of Toxoplasma gondii. (2007 Aug, Traffic) PubMed / full text
   more detail about this publication

inner membrane complex during intracellular tachyzoite

Karnataki, A., Derocher, A., Coppens, I., Nash, C., Feagin, J. E., Parsons, M.
Cell cycle-regulated vesicular trafficking of Toxoplasma APT1, a protein localized to multiple apicoplast membranes. (2007 Mar, Mol Microbiol) PubMed / full text
   more detail about this publication

inner membrane complex during tachyzoite
  • "The schematics depict a composite of all focal planes of the cells, with the outline of the parasites in grey, the inner membrane complex in green, and plastid lumen in red, plastid in different focal planes (F) as dotted red line, and the nucleus in blue. Markers include: HcRed fluorescence (red, apicoplast lumen), anti-IMC1 (pseudocoloured green in designated images, Alexa 680) and DAPI (blue)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH hxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: inner membrane complex during tachyzoite
  • Other genes localised in this publication: hypothetical protein

Gilk, S. D., Raviv, Y., Hu, K., Murray, J. M., Beckers, C. J., Ward, G. E.
Identification of PhIL1, a novel cytoskeletal protein of the Toxoplasma gondii pellicle, through photosensitized labeling with 5-[125I]iodonaphthalene-1-azide. (2006 Oct, Eukaryot Cell) PubMed / full text
   more detail about this publication

beneath alveoli during tachyzoite

Chaudhary, K., Donald, R. G., Nishi, M., Carter, D., Ullman, B., Roos, D. S.
Differential localization of alternatively spliced hypoxanthine-xanthine-guanine phosphoribosyltransferase isoforms in Toxoplasma gondii. (2005 Jun 10, J Biol Chem) PubMed / full text
   more detail about this publication

inner membrane complex during daughter tachyzoites before acquisition of plasma membrane and mother tachyzoite mitotic division
  • "HXGPRT-II-mRFP co-localizes with an IMC1-YFP transgene, confirming association with the IMC rather than the plasma membrane (Fig. 3B)."
  • Microscopy type: Light
  • Microscopy method: YFP tag
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: IMC during mother tachyzoite mitotic division and daughter tachyzoites before acquisition of plasma membrane
  • Other genes localised in this publication: hypoxanthine-xanthine-guanine phosphoribosyl transferase

Dowse, T. J., Pascall, J. C., Brown, K. D., Soldati, D.
Apicomplexan rhomboids have a potential role in microneme protein cleavage during host cell invasion. (2005 Jun, Int J Parasitol) PubMed / full text
   more detail about this publication

inner membrane complex during 20 hours after tachyzoite infection

Hu, K., Roos, D. S., Angel, S. O., Murray, J. M.
Variability and heritability of cell division pathways in Toxoplasma gondii. (2004 Nov 1, J Cell Sci) PubMed / full text
   more detail about this publication

inner membrane complex during tachyzoite mitosis
  • "The h2b-YFP appears green and parasites were also stained with anti-IMCI antibody to show the inner membrane complex (cyan) and DAPI to visualize DNA (red)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: inner membrane complex during tachyzoite mitosis
  • Other genes localised in this publication: histone H2B variant 1

Morrissette, N. S., Sibley, L. D.
Disruption of microtubules uncouples budding and nuclear division in Toxoplasma gondii. (2002 Mar 1, J Cell Sci) PubMed / full text
   more detail about this publication

inner membrane complex and not residual body during intracellular tachyzoite
  • "In order to distinguish daughter parasites from the residual body, we used an antibody (45.15, anti-IMC-1) that recognizes an intermediate-filament-like component of a network that is associated with the inner membrane complex (IMC). In untreated tachyzoites, IMC-1 labeling was localized directly below the plasma membrane and ran from a region directly under the extreme apex of the parasite to a region close to the posterior of the tachyzoite (Fig. 4A, top row). It began in a region coincident with the subpellicular microtubules but extended significantly beyond them. The residual body was not labeled with the IMC-1 antibody."
  • Microscopy type: Light, EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: IMC and not residual body during intracellular tachyzoite
  • Other genes localised in this publication: caltractin (centrin), putative

Mann, T., Beckers, C.
Characterization of the subpellicular network, a filamentous membrane skeletal component in the parasite Toxoplasma gondii. (2001 Jul, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

inner membrane complex during tachyzoite
  • "TgIMC1 and TgIMC2 are localized to the subpellicular network of Toxoplasma"
  • Microscopy type: Light, EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH hxgprt-
  • Gene model mapping comments: Blast from AY032678, annotation matches
  • Localisation record: inner membrane complex during tachyzoite
  • Other genes localised in this publication: serine/threonine protein phosphatase, putative

Striepen, B., Crawford, M. J., Shaw, M. K., Tilney, L. G., Seeber, F., Roos, D. S.
The plastid of Toxoplasma gondii is divided by association with the centrosomes. (2000 Dec 25, J Cell Biol) PubMed / full text
   more detail about this publication

inner membrane complex during tachyzoite schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_37657

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_031640 membrane skeletal protein IMC1
MFKDCADPCSDCCQPAEQQRGQATLPSHVVLPQTSDSPAIHVTAEASQRLSSPRALQQLHGTQESVRSVTLEERADRSRT
VPIGEETERQWVAITAYQPIDTVTKTVEVPVVRTVETYVPKVVVEEKIVEVPKYIPEYVEKVVEVPEVQYVDKIVEVPEY
QYEYKYVPKIETKENIIQRPKYETKYIEKVVEVAQVKEVVRYQDVEEVEEIIRYVPKDSVVPEEWKRIQEEQDKREAELK
EKEAKEEEELKGLLEEERKLHEERVREQIKVQQQIIQQQLSARAEQERLLKERREAEMVHFPAVEGAPPLPTIPKVEQVF
KPKVIKQVEIQKHVPISVDVPVPYMVPKPVVVSVQVPVLKFRDHFVPVPVRRRVVPRIRWTNEVYEVECIKEKPFLQVQD
VIKPVPCDVEIRVHEFVERAAPINPAELSQADIHAMWMRVNADLAEKRKQELGDKYPYVKHPAGTVFGEPGCSEEEGEVE
SAQAEEGGQPAGAEPLALHPGHPLNMTYLQNEWIKKSTVTTHEMYTPEWFEAHQKALFNLTMQQPTQVQLSAEQAAKLQQ
QEAQFGDAPWIEEAHAGVPMKPAAPEPEAAQCCVMCAVCGGDGVCRCQC

Gene-Specific Links for TGME49_031640

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins