ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_031630 (IMC4)

membrane skeletal protein IMC1, putative, a gene from Toxoplasma gondii

Compiled localisation
conoid and daughter inner membrane complex and mother inner membrane complex and subpellicular microtubule during tachyzoite
inner membrane complex
daughter cytoskeleton and mother cytoskeleton during tachyzoite budding

Who localised this protein by microscopy?

Anderson-White, B. R., Ivey, F. D., Cheng, K., Szatanek, T., Lorestani, A., Beckers, C. J., Ferguson, D. J., Sahoo, N., Gubbels, M. J.
A family of intermediate filament-like proteins is sequentially assembled into the cytoskeleton of Toxoplasma gondii. (2011 Jan, Cell Microbiol) PubMed / full text
   more detail about this publication

daughter cytoskeleton and mother cytoskeleton during tachyzoite budding

Hu, K.
Organizational changes of the daughter basal complex during the parasite replication of Toxoplasma gondii. (2008 Jan, PLoS Pathog) PubMed / full text
   more detail about this publication

inner membrane complex
  • "(A) A parasitophorous vacuole with parasites at similar stage as those in Figure 3 expressing mCherryFP-TgMORN1 (pseudo-colored green) and EGFP-TgIMC4 (pseudo-colored red). Faint planar concentrations of IMC (red arrows) are surrounded by the TgMORN1 rings (green arrows)."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: inner membrane complex
  • Other genes localised in this publication: phosphatidylinositol-4-phosphate 5-kinase, putative, caltractin, putative, tubulin alpha chain

Hu, K., Johnson, J., Florens, L., Fraunholz, M., Suravajjala, S., DiLullo, C., Yates, J., Roos, D. S., Murray, J. M.
Cytoskeletal components of an invasion machine--the apical complex of Toxoplasma gondii. (2006 Feb, PLoS Pathog) PubMed / full text
   more detail about this publication

conoid and daughter inner membrane complex and mother inner membrane complex and subpellicular microtubule during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_17979

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_031630 membrane skeletal protein IMC1, putative
MFSECCQPCAPCGEGEPGAAQPTQVPGSRLVSGVVATQGEARILEPLVQERVVEVLKEEIQERVIEVPQVQYVDRIVEVP
QHVVHEKVTHVAKPIIQERVKHVHKPVYQQKIIEVPQVKVVDKIVEVPQYVYQEKIIEVPRVVVQERVIPVPRKVVKEKI
VEISQVDYRDVVVEKPLEAVEILQEEEVVEVPKPVVVEKVVDVEKVVEVPHIQHTYRNVMTPQYRHIPKPVEVPMTHYRP
IPVEKIVDRNVPVPVELQIVQEYLCPKIEPRYKEVPVPVHVQRTIEHPVPKEAMGNPKLLPLYYQGTQEGVEGIVTPGHP
CYSLSACCMPRREQQPIELGTMQGTVEVMAQQGYPTMPVPQGWDGAAPPAGWEGWSKEHIPTALRSDQHSSGAMTPVSAG
AAVGSAPASPARGPEDNQGQQAPHHQAGGEGPFVQVSVTPLAPGQQTQVNIN

Gene-Specific Links for TGME49_031630

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins